DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1463 and ZNHIT6

DIOPT Version :8

Sequence 1:NP_001259489.1 Gene:CG1463 / 32211 FlyBaseID:FBgn0030406 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_060423.3 Gene:ZNHIT6 / 54680 HGNCID:26089 Length:470 Species:Homo sapiens

Alignment Length:272 Identity:80/272 - (29%)
Similarity:140/272 - (51%) Gaps:38/272 - (13%)


  Fly     1 MADETSTK-----------TRTMRLGMCEVCAAKEACYACPKCEVKTCSLPCVQIHKKELNCDGQ 54
            :.|:|..|           .|.:.:..||.|..:||.|.||:|...:||||||:.||.||.|:|.
Human   193 IVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGV 257

  Fly    55 RDRTKFVPLSEMTSREFMSDYCFLEECTRYAENRKSDP-CKRFTHDQRNLPVT---QHRMRMAAK 115
            ||:|.::.:.:.|....:|||.|||:..|.|::...|. .||        |::   .:.|:..|:
Human   258 RDKTAYISIQQFTEMNLLSDYRFLEDVARTADHISRDAFLKR--------PISNKYMYFMKNRAR 314

  Fly   116 KRNINLRLQLENFSRHKENTTYLNWKLGRFHWRIEWLFANIPYEASLPRNVTRFVDKECNEELTL 180
            ::.|||:|....|::.|||:|:.:.|..:|.|.::..|         |::...:::|...::.|:
Human   315 RQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVKLQF---------PQSQAEYIEKRVPDDKTI 370

  Fly   181 PDLVAKYVDLRHE--TAREQRKLLANHQTAGIGQLSFWLRAEGVRRSSTRCYLLDSTKTLAENLV 243
            .:::..|:|....  ..|::.|.....||.    :...::.|.::::..|.|.||..|:|.:||.
Human   371 NEILKPYIDPEKSDPVIRQRLKAYIRSQTG----VQILMKIEYMQQNLVRYYELDPYKSLLDNLR 431

  Fly   244 GKTIVEFPTILV 255
            .|.|:|:||:.|
Human   432 NKVIIEYPTLHV 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1463NP_001259489.1 zf-HIT 17..43 CDD:282314 14/25 (56%)
ZNHIT6NP_060423.3 zf-HIT 217..246 CDD:282314 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C300875587
eggNOG 1 0.900 E1_KOG2858
Hieranoid 1 1.000
Homologene 1 1.000 H32378
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003719
OrthoInspector 1 1.000 T1073336
orthoMCL 1 0.900 OOG5_128706
Panther 1 1.100 LDO PTHR13483
Phylome 1 0.910 0.960 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R130
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.