DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1463 and ZNHIT6

DIOPT Version :9

Sequence 1:NP_001259489.1 Gene:CG1463 / 32211 FlyBaseID:FBgn0030406 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_060423.3 Gene:ZNHIT6 / 54680 HGNCID:26089 Length:470 Species:Homo sapiens


Alignment Length:272 Identity:80/272 - (29%)
Similarity:140/272 - (51%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADETSTK-----------TRTMRLGMCEVCAAKEACYACPKCEVKTCSLPCVQIHKKELNCDGQ 54
            :.|:|..|           .|.:.:..||.|..:||.|.||:|...:||||||:.||.||.|:|.
Human   193 IVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGV 257

  Fly    55 RDRTKFVPLSEMTSREFMSDYCFLEECTRYAENRKSDP-CKRFTHDQRNLPVT---QHRMRMAAK 115
            ||:|.::.:.:.|....:|||.|||:..|.|::...|. .||        |::   .:.|:..|:
Human   258 RDKTAYISIQQFTEMNLLSDYRFLEDVARTADHISRDAFLKR--------PISNKYMYFMKNRAR 314

  Fly   116 KRNINLRLQLENFSRHKENTTYLNWKLGRFHWRIEWLFANIPYEASLPRNVTRFVDKECNEELTL 180
            ::.|||:|....|::.|||:|:.:.|..:|.|.::..|         |::...:::|...::.|:
Human   315 RQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVKLQF---------PQSQAEYIEKRVPDDKTI 370

  Fly   181 PDLVAKYVDLRHE--TAREQRKLLANHQTAGIGQLSFWLRAEGVRRSSTRCYLLDSTKTLAENLV 243
            .:::..|:|....  ..|::.|.....||.    :...::.|.::::..|.|.||..|:|.:||.
Human   371 NEILKPYIDPEKSDPVIRQRLKAYIRSQTG----VQILMKIEYMQQNLVRYYELDPYKSLLDNLR 431

  Fly   244 GKTIVEFPTILV 255
            .|.|:|:||:.|
Human   432 NKVIIEYPTLHV 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1463NP_001259489.1 zf-HIT 17..43 CDD:282314 14/25 (56%)
ZNHIT6NP_060423.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
zf-HIT 217..246 CDD:282314 14/28 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146337
Domainoid 1 1.000 100 1.000 Domainoid score I7041
eggNOG 1 0.900 - - E1_KOG2858
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H32378
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002947
OrthoInspector 1 1.000 - - oto89879
orthoMCL 1 0.900 - - OOG6_102819
Panther 1 1.100 - - LDO PTHR13483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R130
SonicParanoid 1 1.000 - - X3293
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.