DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1463 and SPAC4F10.19c

DIOPT Version :9

Sequence 1:	NP_001259489.1	Gene:	CG1463 / 32211	FlyBaseID:	FBgn0030406	Length:	336	Species:	Drosophila melanogaster
Sequence 2:	NP_594762.1	Gene:	SPAC4F10.19c / 2543613	PomBaseID:	SPAC4F10.19c	Length:	154	Species:	Schizosaccharomyces pombe

Alignment Length:	49	Identity:	18/49 - (36%)
Similarity:	24/49 - (48%)	Gaps:	0/49 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 CEVCAAKEACYACPKCEVKTCSLPCVQIHKKELNCDGQRDRTKFVPLSE 65
            |.:|...|..|.||||....|||||.:||:.:.......:.|.|..:.|
pombe     4 CSICNESEIKYKCPKCSFPYCSLPCWKIHQSQCETVNDNNTTTFKGVKE 52

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1463	NP_001259489.1	zf-HIT	17..43	CDD:282314	13/25 (52%)
SPAC4F10.19c	NP_594762.1	zf-HIT	1..30	CDD:282314	13/25 (52%)
SPAC4F10.19c	NP_594762.1	fungal_TF_MHR	<60..>132	CDD:304923
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R130
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030