DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXC4 and Antp

Sequence 1:NP_055435.2 Gene:HOXC4 HGNCID:5126 Length:264 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:258 Identity:90/259 (35%)
Similarity:106/259 (41%) Gaps:109/259 (42%)


Human    12 YIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELY------PP--PPPRPSYPERQYS 68
            |.|...|...|..||                    ||:..:|      ||  .||          
  Fly   210 YTDVGVPDVTEVHQN--------------------HHNMGMYQQQSGVPPVGAPP---------- 244

Human    69 CTSLQGPGNSRGHGPAQAGHHHPEK----SQSLCEPAPLSGASASPSPAPPACSQPAPDHPSSAA 129
                ||..: :|.||.|....||.:    ||:     |.|.:|..|||                 
  Fly   245 ----QGMMH-QGQGPPQMHQGHPGQHTPPSQN-----PNSQSSGMPSP----------------- 282

Human   130 SKQPIVYPWMK----KIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIA 190
                 :||||:    |..           |.||.|..|||.|.||||||||:|||||||||||||
  Fly   283 -----LYPWMRSQFGKCQ-----------ERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIA 331

Human   191 HSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPP 253
            |:|||:|||||||||||||||||::     |.:..|.:|.               .....|||
  Fly   332 HALCLTERQIKIWFQNRRMKWKKEN-----KTKGEPGSGG---------------EGDEITPP 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXC4NP_055435.2 Antp-type hexapeptide 135..140 4/5 (80%)
Homeobox 159..212 CDD:306543 45/53 (85%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.