DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXC4 and unpg

Sequence 1:NP_055435.2 Gene:HOXC4 HGNCID:5126 Length:264 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:272 Identity:72/273 (26%)
Similarity:103/273 (38%) Gaps:90/273 (33%)


Human    28 YIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSR--GHGPAQAGHHH 90
            |:|. ||..:...::...|...|   ||||..|::...:....:|..|.::|  ...||.||...
  Fly   109 YLPS-SPAGHPAAQQPQAQAQPQ---PPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAP 169

Human    91 PEKS-------------QSLCEPAPLSGASAS-------PSPAPPACSQPAPDHPSSAASKQPIV 135
            .:.|             .||...|.|...:|:       .:|......:|.|....|:.:|....
  Fly   170 TDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSH 234

Human   136 YPWMKKIHVS-----------------TVNP-NYNG----------------------------- 153
            .|....:.|.                 |::| ||||                             
  Fly   235 SPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHE 299

Human   154 -----------------GEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIK 201
                             .:.:|.|||:|.:|:||||:|||..:||:...|.:||.||.|||.|:|
  Fly   300 GGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVK 364

Human   202 IWFQNRRMKWKK 213
            |||||||.|||:
  Fly   365 IWFQNRRAKWKR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXC4NP_055435.2 Antp-type hexapeptide 135..140 1/5 (20%)
Homeobox 159..212 CDD:306543 33/53 (62%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.