DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LIMK1 and cdi

Sequence 1:NP_511139.2 Gene:LIMK1 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster
Sequence 2:NP_524401.2 Gene:cdi FlyBaseID:FBgn0004876 Length:1213 Species:Drosophila melanogaster

Alignment Length:1031 Identity:265/1032 (26%)
Similarity:379/1032 (37%) Gaps:312/1032 (30%)


  Fly   274 PVQVC-RSCSQADIQRAMSASTLILP----LSTSASSVEVGRERLYKTPG----EQGTKARKLRQ 329
            |.::| .|..|.|   :.:||..|.|    :.|:|::|..      .|.|    |...|.:.|..
  Fly    12 PSEICGLSVDQVD---SSAASPFIWPSTAGMCTTATTVTT------STNGDATAEAPVKHQPLHN 67

  Fly   330 ATNASTTIPPAAGATAMTQLKEKERCSSLSKLLDEQHQAQQHSAHPQLYDLSRTQSCRVVQKPQR 394
            .......:|||    .:|:....:|                         |....|||.::....
  Fly    68 GGWIGNGLPPA----PVTRTISSDR-------------------------LVTGSSCRALRTAVS 103

  Fly   395 IFRATDLVIGEKLGEGFFGKVFKVTHRQSGEVMVLK--ELHRADEEAQRNFIKEVAVLRLLDHRH 457
            ...:.|..:.||:|.|||.:|:|||||.:|:|||||  :| ||:   :.|.::||.:|..|.|.:
  Fly   104 ALYSVDDFVKEKIGSGFFSEVYKVTHRTTGQVMVLKMNQL-RAN---RPNMLREVQLLNKLSHAN 164

  Fly   458 VLKFIGVLYKDKKLHMVTEYVAGGCLKELIHDPAQVLPWPQRVRLARDIACGMSYLHSMNIIHRD 522
            :|.|:||..::.:||.:|||:.||.|::|:.:...||...|::|||..||.||||:|...|.|||
  Fly   165 ILSFMGVCVQEGQLHALTEYINGGSLEQLLANKEVVLSATQKIRLALGIARGMSYVHDAGIFHRD 229

  Fly   523 LNSMNCLVR----EDRSVIVADFGLARSVDAPRLPSGNMTPGGYGSGANSDAPMSPSGTLRRSKS 583
            |.|.|.|:|    :....:|.|||||..:..                                  
  Fly   230 LTSKNVLIRNLANDQYEAVVGDFGLAAKIPV---------------------------------- 260

  Fly   584 RQRRQRYTVVGNPYWMAPEMMKGLKYDEKVDVFSFGIMLCEIIGRVEADPDFMPRNSDFSLNQQE 648
            :.|:.|...||:|||::||.:||..||:..|||||||:.||||.|:|||||.|||.:.|.|:...
  Fly   261 KSRKSRLETVGSPYWVSPECLKGQWYDQTSDVFSFGIIQCEIIARIEADPDMMPRTASFGLDYLA 325

  Fly   649 FREKFCAQCPEPFVKVAFVCCDLNPDMRPCFETLHVWLQRLADDLAADRVPPERLLHEIETFQEW 713
            |.|......|..|:::||.||..:...||.|......|..|.          |:..||       
  Fly   326 FVELCPMDTPPVFLRLAFYCCLYDAKSRPTFHDATKKLTLLL----------EKYEHE------- 373

  Fly   714 YASSEDALSPTSQRSLNNLDELVKSAVDSEISPVEKEKENMVIKPQ-DIPKSPHLGKDFSPSGER 777
               |....||.|...|.|            .||...:.||:.:.|: .:|....:..  :|:|  
  Fly   374 ---SSAGASPLSSLELIN------------CSPGGSDSENVTLTPRASVPTVATICT--APAG-- 419

  Fly   778 LRDSMRARRRQRFLGAQEERRNLTPDTESKERALKKALKKCRPFGERGYLVDLRAGAELQLEDVR 842
               ::..|..|..    :|.....|..:|...||...     |.|..|                 
  Fly   420 ---TLTPRHLQEV----DEDGFRFPSKKSASAALPGT-----PNGSAG----------------- 455

  Fly   843 DLNTYSDVDSSCDTSLNYHDVNNLPAAQEDENTVKPGKEELLEESTNKPSNQESQHHRLAIDDMR 907
                    .|..|..:....|..  |.|:.|..:...:..|.|...:.|.      |....|..|
  Fly   456 --------SSGFDDHILKSRVRR--ATQKLEAEILLHRRSLSENIIHFPM------HTSPSDKAR 504

  Fly   908 TRLNQCRSKFEHLEEASRRNFNQSQHSMKNFFKTPPVALKMFQRLEHEAAALNGGNNCPPPPPRT 972
                 |     |..:..|    .|.||     .|||..|...|.         ...:.|.|||..
  Fly   505 -----C-----HQMQRQR----SSTHS-----PTPPRQLSSVQL---------PATSIPDPPPLP 541

  Fly   973 QRINQTPIFGRKNPPVAIV-----------------GQKLQHAESLEDLASSGVAKQL-ATPAPK 1019
            :.:          |.|..:                 |.|....|:|..|  .||.|.| |.|   
  Fly   542 KPV----------PAVLTLRKVGDPQYKPTSEKDHNGSKPNPFEALAQL--RGVKKILDANP--- 591

  Fly  1020 RSKATATTKGGQSSNPPLFLPPSLNISVALNSNGNV---------TTTTNTNSSCPPSASDWLP- 1074
              |..|...|...|:....|.|......|:.|....         |:|.|..|:..||....|| 
  Fly   592 --KTYAAGVGDLFSSCFEMLAPFFKELAAMQSKAGAQGGGTSTEETSTGNKASAATPSEPKSLPV 654

  Fly  1075 -----KKH---KLTLP------LPSAQQQRTSSNHRLPM-------CNNKGKTLKPLPSRTGSQG 1118
                 :|:   :|.||      .|.|.......:..||.       ||::|:.    |...|   
  Fly   655 SPHMTRKYSAIELRLPQRISNAAPPAVTSAPPPSIALPTDEDDCDDCNSEGED----PDGGG--- 712

  Fly  1119 IPASNCVSPTRSS-----RPGS-PT----------KHLAQRHTAATAQRLTNAAATHQQQHQQQS 1167
                ||.....||     ||.: ||          .|...|.:..|:.:.|:..........:.|
  Fly   713 ----NCADAESSSDDSAVRPSTVPTARKYRANSLYAHPLFRGSNGTSMKSTSTGEFESPTLLKAS 773

  Fly  1168 SKTTRLNILSPEKVHRLGAR-----LTDQKQKMREEAAATASSVGGA------GCA 1212
            :.|..|..       .:||.     ||:..:|.:|:|::.|::...|      ||:
  Fly   774 ASTITLTA-------SVGATNSCEDLTESARKSKEQASSGATAAVQALPTPMSGCS 822

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492
TyrKc 401..686 CDD:197581 114/291 (39%)
STKc_LIMK 407..693 CDD:271056 114/292 (39%)
cdiNP_524401.2 TyrKc 113..363 CDD:197581 114/288 (40%)
PKc_like 116..370 CDD:304357 115/302 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87778173
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46485
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.