DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and Irf2bp2

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_003751945.1 Gene:Irf2bp2 RGDID:1589517 Length:571 Species:Rattus norvegicus

Alignment Length:707 Identity:222/708 (31%)
Similarity:286/708 (40%) Gaps:227/708 (32%)


  Fly     5 TKRQHCYLCDLPRMPWAMINDFSEAVCRGCVNYEGADRIEAVLDAARQMKRLHPASKQQRSHENG 69
            ::||.|||.||||||||||.||:|||||||||||||||:|.|::.|||:||.|...::.||    
  Rat    11 SRRQSCYLGDLPRMPWAMIWDFTEAVCRGCVNYEGADRVEFVIETARQLKRAHGCFQEGRS---- 71

  Fly    70 EVSAAAAAAVVLQQQQQLQVGPVPGQGPGSHRGGGGGGPPGAPPGSGGPGPSGAGSL-----SSL 129
                                                  |.||.|.|..|.|..|..|     ..|
  Rat    72 --------------------------------------PTGAQPASAKPPPLSAKDLLLQPPPQL 98

  Fly   130 GNAVAAAAAAAAVHHHHQMPYQMPVPRIGPPLDYPVKLEDAPGGGVRPVRISHMTPHHLPPNATR 194
            |:|.|.||.|.|:..                  ||:..:.||       |::       ...:||
  Rat    99 GHAGAEAARAQAMER------------------YPLGPDRAP-------RLA-------SEFSTR 131

  Fly   195 GGGGAPGGGVPTAGSGGGSLPPALSVNLKRPPSEDVDVDVSQQQQQSGHGLAP------DGSAGN 253
            .|.|.|...........|.|.|.....|:..|    :::......:..|.:.|      :|||..
  Rat   132 AGAGLPQSAASQPSPANGILVPNGFSKLEEQP----ELNRQSPNPRRAHAVPPTLVPLVNGSAAL 192

  Fly   254 SLSAGGGVSGGCPPGIKRSAMDDPSGVGGRPPLTRGESLPAAVSYV----PERQLSGLRDKQQPV 314
            .||.....:        .:|:....|:|.:|........||:||..    ..|:.|  ::|.||.
  Rat   193 GLSGRAAAT--------LAAVSGTPGLGAQPAELGTHKRPASVSSAAAEHEAREQS--KEKAQPA 247

  Fly   315 RAPSFDASTFKAANPIPNPIPHHLHIAEHMSPASRRNGSSPPSGPLPPRSVHSPNSSGSSSGR-R 378
                                        |.|||...:|::..|           ..|..|:|: |
  Rat   248 ----------------------------HRSPADSLSGTTGAS-----------ELSAESAGKGR 273

  Fly   379 SSGSRHVSSTTVTSSEV--------GGSNPGQ-------AVVAGG--LGGGGGGGPGSNAAS--- 423
            :.|.:..:|...|..:.        |.|.|.:       |:.|.|  ||....|..||.|.:   
  Rat   274 APGEQDWASRPKTVRDTLLALHHQHGHSGPFESKFKKEPALTAAGRLLGFEANGANGSKAVARTA 338

  Fly   424 ----------GQLGGPS-GGSGQ--LSCTSGG------PGGSASSGSGGNGAIGPASMAPNSVAG 469
                      |::|.|. .|..|  ||.::.|      |..|..|..       |.:.:|:|...
  Rat   339 RKRKPSPEPEGEVGPPKINGEAQPWLSTSTEGLKIPITPTSSFVSPP-------PPTASPHSNRT 396

  Fly   470 DGSPAGGNGPS-------------GSNGS------------GGSVNPGPGSSGSQGGGGGGTPLA 509
            ....|..||.|             ||:.|            ..|..|.|.|...:..|    |..
  Rat   397 TPPEAAQNGQSPMAALILVADNAGGSHASKDTTQVHSTTRRNSSSPPSPSSMNQRRLG----PRE 457

  Fly   510 SGGGSAGS-GGLGGAPGSSAASNSAAAAAAAAAQNATLKCTLCQERLEDTHFVQCPSVNHHKFCF 573
            .||.:.|| |||.....:|...:|.||       :|.|.||||.||||||||||||||..|||||
  Rat   458 VGGQATGSTGGLEPVHPASLPDSSLAA-------SAPLCCTLCHERLEDTHFVQCPSVPSHKFCF 515

  Fly   574 PCSRESIKRQNGLGNEVYCPSGDRCPLANSVIPWAFMQGEITTILGEEVKVKKERES 630
            ||||:|||:| |...|||||||::|||..|.:|||||||||.|||..:|||||||:|
  Rat   516 PCSRQSIKQQ-GASGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKKERDS 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155 39/51 (76%)
zf-C3HC4 548..593 CDD:278524 36/45 (80%)
Irf2bp2XP_003751945.1 IRF-2BP1_2 12..63 CDD:288155 39/51 (76%)
RING 490..534 CDD:214546 36/45 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84966522
eggNOG 1 0.900 E1_KOG3579
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 289 1.000 Inparanoid score I2675
OMA 1 1.010
OrthoDB 1 1.010 D1156771at2759
OrthoFinder 1 1.000 FOG0005046
OrthoInspector 1 1.000 T617479
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10816
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.