DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and IRF2BPL

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_078772.1 Gene:IRF2BPL HGNCID:14282 Length:796 Species:Homo sapiens

Alignment Length:853 Identity:253/854 (30%)
Similarity:306/854 (36%) Gaps:294/854 (34%)


  Fly     5 TKRQHCYLCDLPRMPWAMINDFSEAVCRGCVNYEGADRIEAVLDAARQMKRLHPASKQQRS---- 65
            ::||.||||||||||||||.||||.|||||||||||||||.|::.|||:||.|...:..||    
Human     9 SRRQSCYLCDLPRMPWAMIWDFSEPVCRGCVNYEGADRIEFVIETARQLKRAHGCFQDGRSPGPP 73

  Fly    66 ------------HENGEVSAAAAAAVVL---------QQQQQLQVGPVPGQGPGSHRGGGGGGPP 109
                        .|....:||||||...         |||||.|......|....:...|...|.
Human    74 PPVGVKTVALSAKEAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQLNHVDGSSKPA 138

  Fly   110 --GAPPGSGGPGPSGAGSLSSLGNAVAAAAAAAAVHHHHQMPYQMPVPRIGPPLDYPVKLEDAPG 172
              .||.|....|.|.|        |.|||||||||....:..|..|...:|.. .:..:|.:..|
Human   139 VLAAPSGLERYGLSAA--------AAAAAAAAAAVEQRSRFEYPPPPVSLGSS-SHTARLPNGLG 194

  Fly   173 GGVRPVRISHMTPHHLPPNATR-------------GGGGAPGG---GVPTAGSGGGS-------- 213
            |   |......||...||...|             ...|..||   |:|..|.|||.        
Human   195 G---PNGFPKPTPEEGPPELNRQSPNSSSAAASVASRRGTHGGLVTGLPNPGGGGGPQLTVPPNL 256

  Fly   214 LP------PALSVNLKRPPSEDVDVDVSQQQQQSGHGL--------APDGSAGNSLSAGGGVSGG 264
            ||      ||.:..|..||.               |.|        ||.|:.|.....||     
Human   257 LPQTLLNGPASAAVLPPPPP---------------HALGSRGPPTPAPPGAPGGPACLGG----- 301

  Fly   265 CPPGIKRSAMDDPS-----------GVGGRPP--------------------------------- 285
             .||:..::....|           |.||:.|                                 
Human   302 -TPGVSATSSSASSSTSSSVAEVGVGAGGKRPGSVSSTDQERELKEKQRNAEALAELSESLRNRA 365

  Fly   286 --------------LTRGESLPAAVSYVPERQLSGLRDKQQPVRAPSFD---------------- 320
                          ||.....|..|.:..:..|.|.......|..|..|                
Human   366 EEWASKPKMVRDTLLTLAGCTPYEVRFKKDHSLLGRVFAFDAVSKPGMDYELKLFIEYPTGSGNV 430

  Fly   321 -----------------------ASTFK--------------------------------AANPI 330
                                   :|.||                                .|:.:
Human   431 YSSASGVAKQMYQDCMKDFGRGLSSGFKYLEYEKKHGSGDWRLLGDLLPEAVRFFKEGVPGADML 495

  Fly   331 PNPIPHHLHIAEHMSPA-----SRRNGSSPPSGPLPPRSVHSPNSSGSSSGRRSSGSRHVSSTTV 390
            |.|   :|..:..|.|.     ||...:.|.:|.|||.   :|:..|:::..|   .|..|....
Human   496 PQP---YLDASCPMLPTALVSLSRAPSAPPGTGALPPA---APSGRGAAASLR---KRKASPEPP 551

  Fly   391 TSSE----VGGSNPGQAVVAG-------GLGGGGGGGPGSNAASGQLGGPSGGSGQLSCTSGGPG 444
            .|:|    :|.....|..:|.       .:..||...||..|     |||......|     ||.
Human   552 DSAEGALKLGEEQQRQQWMANQSEALKLTMSAGGFAAPGHAA-----GGPPPPPPPL-----GPH 606

  Fly   445 GSASSGSGGNGAIGPASMAP-NSVAG---------DGSPAGGNGPSGSNGSGGSVNPG--PGSSG 497
            .:.::........||:.||. .|||.         |||.......|....|...|:|.  ||.  
Human   607 SNRTTPPESAPQNGPSPMAALMSVADTLGTAHSPKDGSSVHSTTASARRNSSSPVSPASVPGQ-- 669

  Fly   498 SQGGGGGGTPLASGGGSAGSGGLGGAPGSSAAS------NSAAAAAAAAAQNATLKCTLCQERLE 556
                    ..|||..|..   .|..||...:|.      :......:..|.:..|.||:|.||||
Human   670 --------RRLASRNGDL---NLQVAPPPPSAHPGMDQVHPQNIPDSPMANSGPLCCTICHERLE 723

  Fly   557 DTHFVQCPSVNHHKFCFPCSRESIKRQNGLGNEVYCPSGDRCPLANSVIPWAFMQGEITTILGEE 621
            ||||||||||..|||||||||||||.|...| |||||||::|||..|.:|||||||||.|||..:
Human   724 DTHFVQCPSVPSHKFCFPCSRESIKAQGATG-EVYCPSGEKCPLVGSNVPWAFMQGEIATILAGD 787

  Fly   622 VKVKKERE 629
            |||||||:
Human   788 VKVKKERD 795

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155 41/51 (80%)
zf-C3HC4 548..593 CDD:278524 36/45 (80%)
IRF2BPLNP_078772.1 IRF-2BP1_2 10..61 CDD:288155 41/51 (80%)
RING 715..759 CDD:214546 36/45 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85072708
eggNOG 1 0.900 E1_KOG3579
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I3106
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1156771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T608544
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10816
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3014
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.