DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and myt1la

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001038364.1 Gene:myt1la ZFINID:ZDB-GENE-041001-172 Length:1257 Species:Danio rerio

Alignment Length:691 Identity:141/692 (20%)
Similarity:205/692 (30%) Gaps:225/692 (33%)


  Fly    48 DAARQMKRLHPASKQQRSHENGEVSAAAAAAVVLQQQQQLQVGPVPGQGP---------GSHR-- 101
            |.||::....|:.:....|.....|..       ||.|.|...|.|...|         ..||  
Zfish   361 DLARKLSETQPSERPLMEHHMQHHSEQ-------QQPQHLHPHPHPHHPPMPRYDSCQMDQHRPL 418

  Fly   102 -----------------GGGGGGPPGAPPGSGGPGPSGA-------------GSLSSLGNAVAAA 136
                             .....|.|.:....|....:..             |:||.|..|:|..
Zfish   419 ERNYSDMVNLMKLEEQLSPASRGYPSSCAQDGDEDTTSVASDRSDEAFDMTKGNLSLLEKAIALE 483

  Fly   137 AAAAAVHHHHQMPYQMPVPRIGPPLDYPVKLEDAPGGGVRPVRISHMTPHH------LPPNATRG 195
            :..|.|........||...|....|........:.....|..|:     ||      ..|..:| 
Zfish   484 SERAKVMRDRMASEQMVARRDNQRLHGEHSPRQSSSAEERKARL-----HHDGAKRAYYPKDSR- 542

  Fly   196 GGGAPGGGVPTAGSGGGSLPPALSVNLKRPPSEDVDVDVSQQQQQSGH--GLAPDGSAGNSLSAG 258
             |.......||.|..|                             :||  ||.|.   ..|||  
Zfish   543 -GEKKESKCPTPGCDG-----------------------------TGHVTGLYPH---HRSLS-- 572

  Fly   259 GGVSGGC------PPGI---KRSAMDDPS-GVGGRPPLTRGESLPAAVSYVP---ERQLSGLRDK 310
                 ||      ||.|   ..:.:..|: |..||..:....:...::|..|   ..:::.:::|
Zfish   573 -----GCPHKDRVPPEILAMYENVLKCPTPGCSGRGHVNSNRNSHRSLSGCPIAAAEKMAKVQEK 632

  Fly   311 QQPVRAPSFDASTFKAANP-----------------IPNPIPHHLHIA---EHMSPASRRNGSSP 355
            ......|..:.::.:...|                 :|...|.. ::|   |..|.||....::.
Zfish   633 HHSCDGPKSNQASDRVLRPMCFVKQLEIPEYGYKNNVPTSTPRS-NLAKELEKYSKASFDYSNTY 696

  Fly   356 PSGP-------LPPRSVHSPNSS--GSSSGRRSSGSRHVSSTTVTSSEVGGSNPGQAVVAGGLGG 411
            .:.|       |.|:| |..::|  |..:.|....|...||||   |....|:.......||.||
Zfish   697 ENQPHAYGKRSLIPKS-HGRDTSPKGYDAKRYCKTSSPASSTT---SSYAPSSSSSLSCGGGGGG 757

  Fly   412 GGGGGPGSNAASGQLGGPSGGSGQLSCTSGGPGGSASSGSGGNGAIGPASMA------PNSVAGD 470
            |||||.||:|:|             :|:......:....:....|....:::      |.|:|..
Zfish   758 GGGGGGGSSASS-------------TCSKSSFDYTHDMEAAHMAATAILNLSTRCREMPQSLAAK 809

  Fly   471 GSPAGGNGPSGSNGSGGSVNPGPGSSGSQGGGGGGTPLASGGGSAGSGGLGGAPGSSAASNSAAA 535
            |.......|...:|. .|.....|..|..|.|.|||.|              .|....:....|.
Zfish   810 GPELLAQSPDDRDGD-DSRALDVGRVGGMGEGSGGTVL--------------TPLQPMSPQRQAL 859

  Fly   536 AAAAAAQNATLKC----------------------TLCQERLEDTHF---VQCPSVNHHKFCFPC 575
            ..:...|.:|..|                      ...|:.|||..:   |..||.. ||:. ||
Zfish   860 LNSHCYQMSTADCWDLPVDYTKIKRLDDDHKEDDLDPFQDLLEDQQYSGEVSLPSPK-HKYA-PC 922

  Fly   576 SRESIKRQNGLGNEVYCPSGDRCPLANSVIPWAFMQGEITT 616
             :||.|....|.:         |.||:.     .|:|.:|:
Zfish   923 -KESKKELLTLSS---------CQLADK-----GMRGMMTS 948

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155 3/9 (33%)
zf-C3HC4 548..593 CDD:278524 16/70 (23%)
myt1laNP_001038364.1 zf-C2HC 26..52 CDD:279824
zf-C2HC 549..575 CDD:279824 14/65 (22%)
zf-C2HC 593..619 CDD:279824 5/26 (19%)
MYT1 665..922 CDD:285648 67/292 (23%)
zf-C2HC 954..980 CDD:279824
zf-C2HC 1003..1029 CDD:279824
zf-C2HC 1057..1082 CDD:279824
DUF342 <1112..1185 CDD:302792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85300096
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.