DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and myt1a

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_009295274.1 Gene:myt1a ZFINID:ZDB-GENE-030131-3885 Length:1201 Species:Danio rerio

Alignment Length:653 Identity:121/654 (19%)
Similarity:193/654 (30%) Gaps:244/654 (37%)


  Fly   124 GSLSSLGNAVAAAA-----AAAAVHHHHQMPYQMPVPRIGPPLDYPV----------KLE----- 168
            |:|..|..|:|..|     ::...:...|.||.....|....:|...          :||     
Zfish   437 GNLGLLEQAIALKAEQTGHSSEESYSPEQQPYHSLDDRTSKVMDIAARRAYYGKDGSRLEKKEVK 501

  Fly   169 ------DAPGGGVRPVRISHMTPHHLPPNATRGGGGAPGGGVPTAGSGGGSLPP---ALSVNLKR 224
                  |..|      .::.:.|||      |...|.|         ....:||   |:..|:.:
Zfish   502 CPTPGCDGTG------HVTGLYPHH------RSLSGCP---------HKDRIPPEILAMHENVLK 545

  Fly   225 PPSEDVDVDVSQQQQQSGHGLAPDGSAGNSLSAGGGVSGGCP---PGIKRS---------AMDDP 277
            .|:.               |....|...::.:....:| |||   .|..:|         ::.||
Zfish   546 CPTP---------------GCTGQGHVNSNRNTHRSLS-GCPIAAAGKHKSHDKQSQPQTSVIDP 594

  Fly   278 SGVGG------RPP-LTRGESLPAAVSY----VPERQLSGLRDKQQPVRAPSFDASTFKAANPIP 331
            :.||.      ||. ..:...:|...||    :|....:.|..:.:.....|||.::|..     
Zfish   595 ASVGSNSDRVLRPMCFVKQLEIPQYGSYRTNAMPATPRANLAKELEKYSKVSFDYASFDV----- 654

  Fly   332 NPIPHHLHIAEHMSPASRRNGSSP--------PSGPLPPRSVHSPNSSGSSSGRRSSG------- 381
                 .:.....::|....:.:||        |..|.|..|: |...:.|||...|||       
Zfish   655 -----QVFGKRMLAPKMPTSETSPKAFKSILIPKAPSPSHSL-SGGYTKSSSSSTSSGYDYTHDA 713

  Fly   382 -SRHVSSTTVTS---------SEVGGSNPGQAVVAGGLGGGGGGGPGSNAASGQLGGPSGGSGQL 436
             :.|:::|.:.:         ..:....|.||              |.:.   .:.....|:..|
Zfish   714 EAAHMAATAILNLSTRCWERPENLSTRPPDQA--------------GKDM---DIEVDENGTLDL 761

  Fly   437 S--------CTSGGPGGSASSGSGGNGAIGPASM-----------------------APNSVA-- 468
            |        ..|..|..|:||.|..:|...|.|.                       .|..|.  
Zfish   762 SMKKPKREGVRSPDPSSSSSSSSQHHGVTSPHSSHTYKQEEWEGPLDYTKSNRQKEEEPEEVEYT 826

  Fly   469 -----------GDGSPAGGNG---PSGSNGSGGSVN-------------PGPGSSGSQGGGG--- 503
                       .||:..|...   |.....|...|.             |.||..||....|   
Zfish   827 THSYASSDGEDDDGTQEGAEDRTYPGEVTTSSYKVKFQPKDLKKEILLCPTPGCDGSGHITGNYA 891

  Fly   504 -----GGTPLASGG--------------GSAGSGGLGGAPGSSAASNSAAAAAAAAAQNATLKCT 549
                 .|.|||...              .:.|..|.|...|:.|:..|  .:....|:...:|.|
Zfish   892 SHRSLSGCPLADKSLRTLMAAHTAELKCPTPGCDGSGHITGNYASHRS--LSGCPRAKKGGIKTT 954

  Fly   550 LCQERLEDTHFVQCP-----SVNH-------HKFCFPCSRESIKRQNGLGN------EVYCPSGD 596
            ..::..||:..::||     |:.|       |:..:.|...:.:::.|:.|      :.:...|.
Zfish   955 PTKDDKEDSELIKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGMLNGTPFSWKAFKTEGP 1019

  Fly   597 RCP 599
            .||
Zfish  1020 TCP 1022

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155
zf-C3HC4 548..593 CDD:278524 11/63 (17%)
myt1aXP_009295274.1 zf-C2HC 68..96 CDD:307601
zf-C2HC 501..527 CDD:307601 7/38 (18%)
zf-C2HC 545..573 CDD:307601 7/44 (16%)
MYT1 622..866 CDD:312093 47/272 (17%)
zf-C2HC 875..902 CDD:307601 9/27 (33%)
zf-C2HC 918..946 CDD:307601 6/30 (20%)
zf-C2HC 967..995 CDD:307601 6/28 (21%)
zf-C2HC 1021..1048 CDD:307601 2/3 (67%)
EzrA <1061..>1138 CDD:330550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85364607
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.