DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and irf2bp2b

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_999917.1 Gene:irf2bp2b ZFINID:ZDB-GENE-040426-2574 Length:501 Species:Danio rerio

Alignment Length:669 Identity:209/670 (31%)
Similarity:261/670 (39%) Gaps:221/670 (33%)


  Fly     5 TKRQHCYLCDLPRMPWAMINDFSEAVCRGCVNYEGADRIEAVLDAARQMKRLHPASKQQRSHENG 69
            ::||.||||||||||||||.||:|.|||||||||||||||.|::.|||:||.|            
Zfish     9 SRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRIEFVIETARQLKRAH------------ 61

  Fly    70 EVSAAAAAAVVLQQQQQLQVGPVPGQGPGSHRGGGGGGPPG--------APPGSGGPGPSGAGSL 126
                                |...|:.||.      .|.||        |.|||..|.|.....|
Zfish    62 --------------------GFQEGRSPGP------VGKPGKDMQSINHAEPGSRPPQPLDRYPL 100

  Fly   127 SS-----LGNAVAAAAAAAAVHHHHQMPYQMPVPRIGPPLDYPVKLEDAPGGGVRPVRISHMTPH 186
            :|     ||            ..:.:....:|||...|..|.|.:|                  :
Zfish   101 TSDRPPRLG------------AEYQRQANGIPVPNGFPKPDEPPEL------------------N 135

  Fly   187 HLPPNATRGGGGAPGGGVPTAGSGGGSLPPALSVNLKRPPSEDVDVDVSQQQQQSGHGLAPDGSA 251
            ...||..| .|..|...||..   .||:||..::|                              
Zfish   136 RQSPNPRR-TGAIPPNLVPLV---NGSMPPVHALN------------------------------ 166

  Fly   252 GNSLSAGGGVSGGCPPGI------KRS----------AMDDPSGVGGRPPLTRGESLPAAVSYVP 300
                  |..|..|.|||.      ||:          :|.|||  .|...:.........|..:.
Zfish   167 ------GRSVQMGIPPGALAEHVGKRADDMKDKHRADSMSDPS--DGHKRVDEWTQKGKTVREMM 223

  Fly   301 ERQLSGLRDKQQPVRAP---SFDAST--FKAANPIPNPIPHHLHIAEHMSP-------ASRRNGS 353
            ..|....|.|::....|   |:::|:  .|....     .|...|....||       |.:.||.
Zfish   224 TLQTLDSRFKKEHAALPHRMSYESSSGALKTDRG-----KHSRGIKRKTSPEPDGEGIAVKLNGE 283

  Fly   354 SPPSGPLPPRSVHSPNSS--GSSSGRRSSGSRHVSSTTVTSSEVGGSNPGQAVVAGGLGGGGGGG 416
            ..|..|.|...:..|:::  |.::...|:.|.| |.||...:.....| .|:.:|..:......|
Zfish   284 GQPWLPSPSEVLKMPSAALPGFAAAPPSTISPH-SRTTPPEAATAVQN-SQSPMAALILAADNAG 346

  Fly   417 PGSNAASGQLGGPSGGSGQLSCTSGGPGGSASSGSGGNGAIGPASMAPNSVAGDGSPA-GGNGPS 480
            .||         |.....|:..|:....|..:|||       |.|.:    ||...|| |..|.:
Zfish   347 TGS---------PKDAGNQVHSTTTSAAGRRNSGS-------PQSPS----AGQRRPALGATGTA 391

  Fly   481 GSNGSGGSVNPGPGSSGSQGGGGGGTPLASGGGSAGSGGLGGAPGSSAASNSAAAAAAAAAQNAT 545
            ...|    ::|..|...|                        .|.||...:|           ..
Zfish   392 HIPG----MDPQAGHPHS------------------------IPDSSVPPSS-----------VP 417

  Fly   546 LKCTLCQERLEDTHFVQCPSVNHHKFCFPCSRESIKRQNGLGNEVYCPSGDRCPLANSVIPWAFM 610
            |.||||.||||||||||||||..|||||||||||||:|...| |||||||::|||..|.:|||||
Zfish   418 LCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRESIKQQGATG-EVYCPSGEKCPLVGSNVPWAFM 481

  Fly   611 QGEITTILGEEVKVKKERE 629
            ||||.|||..:|||||||:
Zfish   482 QGEIATILAGDVKVKKERD 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155 40/51 (78%)
zf-C3HC4 548..593 CDD:278524 37/45 (82%)
irf2bp2bNP_999917.1 IRF-2BP1_2 10..61 CDD:288155 40/51 (78%)
Cys-rich 420..467 40/48 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84947537
eggNOG 1 0.900 E1_KOG3579
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I2932
OMA 1 1.010
OrthoDB 1 1.010 D1156771at2759
OrthoFinder 1 1.000 FOG0005046
OrthoInspector 1 1.000 T596060
orthoMCL 1 0.900 OOG5_138345
Panther 1 1.100 O PTHR10816
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.