DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and IRF2BP2

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_892017.2 Gene:IRF2BP2 HGNCID:21729 Length:587 Species:Homo sapiens

Alignment Length:696 Identity:222/697 (32%)
Similarity:287/697 (41%) Gaps:189/697 (27%)


  Fly     5 TKRQHCYLCDLPRMPWAMINDFSEAVCRGCVNYEGADRIEAVLDAARQMKRLHPASKQQRSHENG 69
            ::||.||||||||||||||.||:|.|||||||||||||:|.|::.|||:||.|....:.||....
Human    11 SRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRVEFVIETARQLKRAHGCFPEGRSPPGA 75

  Fly    70 EVSAAA------AAAVVLQQQQQLQVGPVPGQGPGSHRGGGGGGPPGAPPGSGG----PGPSGAG 124
            ..||||      |..::|||||||                |.|||..||.....    |..:.|.
Human    76 AASAAAKPPPLSAKDILLQQQQQL----------------GHGGPEAAPRAPQALERYPLAAAAE 124

  Fly   125 SLSSLGNAVAAAAAAAAVHHHHQMPYQMPVPRIGPPLDYPV----------KLEDAP-------- 171
            ....||:...::..||::       .|.|.|:  ||   ||          |||:.|        
Human   125 RPPRLGSDFGSSRPAASL-------AQPPTPQ--PP---PVNGILVPNGFSKLEEPPELNRQSPN 177

  Fly   172 ---GGGVRPVRISHMTPHHLP-PNATRGGGGAPGGGVPTAGSGGGSLPPALSVNL---KRPPSED 229
               |..|.|..:..|.....| |.|...||.|.......:|:...||..|...:|   |||.|..
Human   178 PRRGHAVPPTLVPLMNGSATPLPTALGLGGRAAASLAAVSGTAAASLGSAQPTDLGAHKRPASVS 242

  Fly   230 VDVDVSQQQQQSG---HGLAPDGSAG--NSLSAGGGVSGGCPPGIKRSAMDDPSGVGGRPPLTR- 288
            ....|..:|:::.   ....|....|  :|||...|.:.....|..:|..........||...| 
Human   243 SSAAVEHEQREAAAKEKQPPPPAHRGPADSLSTAAGAAELSAEGAGKSRGSGEQDWVNRPKTVRD 307

  Fly   289 --------GESLPAAVSYVPERQLSGLRDKQQPV----RAPSFDASTFKAANPIPNPIPHHLHIA 341
                    |.|.|....:           |::|.    |...|:|:....:..:..         
Human   308 TLLALHQHGHSGPFESKF-----------KKEPALTAGRLLGFEANGANGSKAVAR--------- 352

  Fly   342 EHMSPASRRNGSSPPSGPLPPRSVH---SPNSSGSSSGRR--------------SSGSRHVSSTT 389
                .|.:|..|..|.|.:.|..::   .|..|.|:.|.:              .:.|.|.:.||
Human   353 ----TARKRKPSPEPEGEVGPPKINGEAQPWLSTSTEGLKIPMTPTSSFVSPPPPTASPHSNRTT 413

  Fly   390 VTSSEVGGSNPGQAVVAGGLGGGGGGGPGSNAASGQLGGPSGGSGQLSCTSGGPGGSASSGSGGN 454
            ...:...|.:|..|::.  :....||...|..|:           |:..|:.....|..|     
Human   414 PPEAAQNGQSPMAALIL--VADNAGGSHASKDAN-----------QVHSTTRRNSNSPPS----- 460

  Fly   455 GAIGPASMAPNSVAGDGSPAGGNGPSGSNGSGGSVNPGPGSSGSQGGGGGGTPLASGGGSAGSGG 519
                |:||....:                        ||...|.||.|             .:||
Human   461 ----PSSMNQRRL------------------------GPREVGGQGAG-------------NTGG 484

  Fly   520 LGGAPGSSAASNSAAAAAAAAAQNATLKCTLCQERLEDTHFVQCPSVNHHKFCFPCSRESIKRQN 584
            |.....:|...:|.|.       :|.|.||||.||||||||||||||..|||||||||:|||:| 
Human   485 LEPVHPASLPDSSLAT-------SAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSIKQQ- 541

  Fly   585 GLGNEVYCPSGDRCPLANSVIPWAFMQGEITTILGEEVKVKKERES 630
            |...|||||||::|||..|.:|||||||||.|||..:|||||||:|
Human   542 GASGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKKERDS 587

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155 39/51 (76%)
zf-C3HC4 548..593 CDD:278524 36/45 (80%)
IRF2BP2NP_892017.2 IRF-2BP1_2 12..63 CDD:288155 39/51 (76%)
Nuclear localization signal. {ECO:0000269|PubMed:21887377} 354..361 3/7 (43%)
Cys-rich 506..550 36/45 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84965535
eggNOG 1 0.900 E1_KOG3579
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1156771at2759
OrthoFinder 1 1.000 FOG0005046
OrthoInspector 1 1.000 T608544
orthoMCL 1 0.900 OOG5_138345
Panther 1 1.100 O PTHR10816
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5742
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.