DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and irf2bpl

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_997852.1 Gene:irf2bpl ZFINID:ZDB-GENE-040426-1968 Length:662 Species:Danio rerio

Alignment Length:763 Identity:228/764 (30%)
Similarity:286/764 (37%) Gaps:248/764 (32%)


  Fly     5 TKRQHCYLCDLPRMPWAMINDFSEAVCRGCVNYEGADRIEAVLDAARQMKRLH------------ 57
            ::||.||||||||||||||.||:|.|||||||||||||||.|::.||.:||.|            
Zfish     9 SRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRIEFVIETARHLKRAHGFQEGRSPGPAP 73

  Fly    58 -PASKQQ------RSHENGEVSAAAAAAVVLQQQQQLQVG-----------PVPGQGPGSHR-GG 103
             ||.|.|      .|.:...|..::.:....|||||.|.|           .......|:|| ..
Zfish    74 PPAVKAQAGMSSKESVQMNHVDGSSKSQQQQQQQQQQQSGLDRYALATERSRFDYSSIGAHRLPN 138

  Fly   104 GGGGPPGAPPGSGGPGPSGAGSLSSLGNAVAAAAAAAAVHHHHQMPYQMPVPRIGPPLDYPVKLE 168
            |.|||.|.|....||......|.:|..|....|.:.           ||.|    ||...|..|.
Zfish   139 GLGGPNGFPKSDDGPPELNRQSPNSRRNHGLVAVSG-----------QMSV----PPNLLPQTLL 188

  Fly   169 DAPGGGVRPVRISHMTPHHLPPNATRGGGGAPGGGVPTAGSGGGSLPPALSVNLKRP---PSEDV 230
            :.|                 |.:|:.......|...|...|.|.:|  |||...|||   .|.|.
Zfish   189 NGP-----------------PSSASIAQHSLSGRAPPAPASIGPAL--ALSEQGKRPGSVSSTDQ 234

  Fly   231 DVDVSQQQQ-------------------------------------------QSGHGLA------ 246
            :.|:.::|:                                           :..|.|.      
Zfish   235 ERDLKEKQRNAEALTELGESLRNRSEEWTNKPKIVRDTLITLSNCTPFDVRFKKDHSLLGRVFAF 299

  Fly   247 ------------------PDGSAGNSLSAGGGVS------------GGCPPGIKRSAMDDPSGVG 281
                              |.|| ||..|:..||:            .|...|.|....:.....|
Zfish   300 DATSKPGMDYELKIFIEYPSGS-GNVFSSASGVAKQMYQDCMKDFGRGLSSGFKYLEYEKKHSSG 363

  Fly   282 GRPPLTRGESLPAAVSYVPERQLSGLRDKQQPVRAPSFDASTFKAANPIPNPIPHHLHIAEHMSP 346
            ....|  |:.||.:|.:..|    ||..:..|  .|..|||.         |:            
Zfish   364 DWRLL--GDLLPESVRFFKE----GLGGEMLP--QPYIDASC---------PL------------ 399

  Fly   347 ASRRNGSSPPSGPLPPRSVHSPNSSGSSSGRRSSGSRHVSSTTVTSSE---------VGGSNPGQ 402
                         ||...|:.|.:..|.|..|:...:..:|....|:|         ...|...:
Zfish   400 -------------LPSALVNMPRAVASGSALRTGVRKRKASPEPDSAEGEQQRQQWMASQSEALK 451

  Fly   403 AVVAGGLGGGGGGGP------GSNAASGQLGGPSGGSGQLSC--TSGGPGGSASSGSGGNGAIGP 459
            ..:|.|......|||      .|:.|:.....|..|...::.  :.....|:|.|....|.....
Zfish   452 LTMASGSFAASHGGPPPLGSVHSSRATPPESAPQNGQSPMAALMSVADTLGNAHSPKDSNSVHST 516

  Fly   460 AS--------MAPNSVAGDGSPAGGNGPSGSNGSGGSVNPGPGSSGSQGGGGGGTPLASGGGSAG 516
            .|        ::|.||:|....|..||..|.:|:       |..|||..|.....|         
Zfish   517 TSTRHNSSSPVSPASVSGQRRLASRNGEMGLSGT-------PSQSGSHQGMDQVHP--------- 565

  Fly   517 SGGLGGAPGSSAASNSAAAAAAAAAQNATLKCTLCQERLEDTHFVQCPSVNHHKFCFPCSRESIK 581
                ...|.|..|:            |..|.||:|.||||||||||||||.:|||||||||||||
Zfish   566 ----QNIPDSPMAN------------NGPLCCTICHERLEDTHFVQCPSVPNHKFCFPCSRESIK 614

  Fly   582 RQNGLGNEVYCPSGDRCPLANSVIPWAFMQGEITTILGEEVKVKKERE 629
            .|...| |||||||::|||..|.:|||||||||.|||..:|||||||:
Zfish   615 AQGATG-EVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKKERD 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155 39/51 (76%)
zf-C3HC4 548..593 CDD:278524 36/45 (80%)
irf2bplNP_997852.1 IRF-2BP1_2 10..61 CDD:288155 39/51 (76%)
RING 581..625 CDD:214546 36/45 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85062666
eggNOG 1 0.900 E1_KOG3579
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I2932
OMA 1 1.010
OrthoDB 1 1.010 D1156771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596060
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10816
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3014
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.