DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and Irf2bp1

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001100953.1 Gene:Irf2bp1 RGDID:1308312 Length:584 Species:Rattus norvegicus

Alignment Length:733 Identity:219/734 (30%)
Similarity:286/734 (39%) Gaps:264/734 (36%)


  Fly     5 TKRQHCYLCDLPRMPWAMINDFSEAVCRGCVNYEGADRIEAVLDAARQMKRLH----------PA 59
            ::||.|||||||:|||||:.||||||||||||:|||||||.::|||||:||.|          ||
  Rat     7 SRRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSHVLPEGRSPGPPA 71

  Fly    60 SKQQRSHENGEVSAAAAAAVVLQQQQQLQVGPVPGQGPGSHRGGGGGGPPGAPPGSGGPGPSGAG 124
            .|...|.:.....:           |..|:.|...|...|..||...||                
  Rat    72 LKHPTSKDLASTGS-----------QGSQLPPPQAQAQPSGTGGSVSGP---------------- 109

  Fly   125 SLSSLGNAVAAAAAAAAVHHHHQMPYQMPVP----RIGPPLDYPVKLEDAPGGGVRPVRISHMTP 185
              .....|.:::..|            :|.|    .:|..|...:..|:|...|.|...:..: |
  Rat   110 --DRYDRATSSSRLA------------LPSPALEYTLGSRLANGLGREEAVAEGARRALLGSI-P 159

  Fly   186 HHLPPNATRGGGGAPGGGVPTAGSGGGSLPPALSVNLKRPP-SEDVDVDVSQQQQQSGHGLAPDG 249
            ..:||...         ....:|.||.:|..|..::..||. ..|.:   .::||::...||...
  Rat   160 SLMPPGLL---------AAAVSGLGGRALTLAPGLSPARPLFGSDFE---KEKQQRNADCLAELN 212

  Fly   250 SAGN------------------SLSA----------GGGVSG--------GCPPGIK---RSAMD 275
            .|..                  :|||          ..|:.|        ..|||.:   :...:
  Rat   213 EAMRGRAEEWHGRPKAVREQLLALSACAPFNVRFKKDHGLVGRVFAFDATARPPGYEFELKLFTE 277

  Fly   276 DPSGVGG-----------------RPPLTRGESLPAA----VSYVPE------RQL-----SGLR 308
            .|.|.|.                 |.|   |::|.::    :.|...      |||     .|:|
  Rat   278 YPCGSGNVYAGVLAVARQMFHDALREP---GKALASSGFKYLEYERRHGSGEWRQLGELLTDGVR 339

  Fly   309 DKQQPVRAPSFDASTFKAANPIPNPIPHHLHIAEHMSPASRRNGSSPPS------GPLPPRSVHS 367
            ..::|  ||         |..:|...|         .||.......||.      .|.|.|...|
  Rat   340 SFREP--AP---------AEALPQQYP---------EPAPAALCGPPPRAPSRNLAPTPRRRKAS 384

  Fly   368 PNSSGSSSGRRSS---GSRH-VSSTTVTSSEVGG-SNPGQAV--VAGGLG------GGGGGGPGS 419
            |...|.::|:.::   ..|| |:.....|:|..| .:|..|:  ||..||      |||||    
  Rat   385 PEPEGETAGKMTTEEQQQRHWVAPGGPYSTETPGVPSPIAALKNVAEALGHSPKDPGGGGG---- 445

  Fly   420 NAASGQLGGPSGGSGQLSCTSGGPGGSASSGSGGNGAIGPASMAPNS---VAGDGSPAGGNGPSG 481
                             |..:||...:|||          .:..|..   ||.:|.         
  Rat   446 -----------------SVRAGGASPAASS----------TTQPPTQHRLVARNGE--------- 474

  Fly   482 SNGSGGSVNPGPGSSGSQGGGGGGTPLASGGGSAGSGGLGGAPGSSAASNSAAAAAAAAAQNATL 546
                 ..|:|..|:....|||            :|:|...|||                     |
  Rat   475 -----AEVSPTAGAEAVSGGG------------SGTGATPGAP---------------------L 501

  Fly   547 KCTLCQERLEDTHFVQCPSVNHHKFCFPCSRESIKRQNGLGNEVYCPSGDRCPLANSVIPWAFMQ 611
            .||||:||||||||||||||..||||||||||.||.| |...||||||||:|||..|.:||||||
  Rat   502 CCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQ-GPAGEVYCPSGDKCPLVGSSVPWAFMQ 565

  Fly   612 GEITTILGEEVKVKKERE 629
            |||.|||..::||||||:
  Rat   566 GEIATILAGDIKVKKERD 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155 40/51 (78%)
zf-C3HC4 548..593 CDD:278524 36/45 (80%)
Irf2bp1NP_001100953.1 IRF-2BP1_2 8..59 CDD:288155 40/51 (78%)
zf-C3HC4 503..547 CDD:278524 36/45 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85249198
eggNOG 1 0.900 E1_KOG3579
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 289 1.000 Inparanoid score I2675
OMA 1 1.010
OrthoDB 1 1.010 D1156771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T617479
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10816
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
109.870

Return to query results.
Submit another query.