DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and Irf2bp2

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001158070.1 Gene:Irf2bp2 MGIID:2443921 Length:570 Species:Mus musculus

Alignment Length:700 Identity:221/700 (32%)
Similarity:287/700 (41%) Gaps:214/700 (31%)


  Fly     5 TKRQHCYLCDLPRMPWAMINDFSEAVCRGCVNYEGADRIEAVLDAARQMKRLHPASKQQRSHENG 69
            ::||.||||||||||||||.||:|.|||||||||||||:|.|::.|||:||.|....:.||    
Mouse    11 SRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRVEFVIETARQLKRAHGCFPEGRS---- 71

  Fly    70 EVSAAAAAAVVLQQQQQLQVGPVPGQGPGSHRGGGGGGPPGAPPGSGGPGPSGAGSL-----SSL 129
                                                  |.||.|.:..|.|..|..|     ..|
Mouse    72 --------------------------------------PTGAQPAAAKPPPLSAKDLLLQPPPQL 98

  Fly   130 GNAVAAAAAAAAVHHHHQMPYQMPVPRIGPPLDYPVKLEDAPGGGVRPVRISHMTPHHLPPNATR 194
            |:|.|.||.|.|:..                  ||:..:.||       |::       ...:||
Mouse    99 GHAGAEAARAQAMER------------------YPLAPDRAP-------RLA-------SDFSTR 131

  Fly   195 GGGGAPGGGVPTAGSGGGSLPPALSVNLKRPPSEDVDVDVSQQQQQSGHGLAP------DGSAGN 253
            .|.|.|......:....|.|.|.....|:.||    :::......:..|.:.|      :|||..
Mouse   132 AGAGLPQSAAQQSAPANGILVPNGFSKLEEPP----ELNRQSPNPRRAHAVPPTLVPLVNGSAAL 192

  Fly   254 SLSAGGGVSGGCPPGIKRSAMDDPSGVGGRPPLTRGESLPAAVSYVPERQLSGLRDKQQPVRAPS 318
            .||.....:        .:|:....|:|.:|........||:||...         .:...|.||
Mouse   193 GLSGRAAAT--------LAAVSGTPGLGAQPAELGTHKRPASVSSAA---------AEHEAREPS 240

  Fly   319 FDASTFKAANPIPNPIPHHLHIAEHMSPASRRNGSSPPSGPLPPRSVHSPNSSGSSSGRR----- 378
            .:.:.           |.|...|:.:|.|:   |:|..|            :.|:..||.     
Mouse   241 KEKAQ-----------PAHRSPADSLSSAA---GASELS------------AEGAGKGRAPGEQD 279

  Fly   379 -SSGSRHVSSTTVTSSEVGGSNPGQ-------AVVAGG--LGGGGGGGPGSNAAS---------- 423
             :|..:.|..|.:...:.|.|.|.:       |:.|.|  ||....|..||.|.:          
Mouse   280 WASRPKTVRDTLLALHQHGHSGPFESKFKKEPALTAAGRLLGFEANGANGSKAVARTARKRKPSP 344

  Fly   424 ---GQLGGPS-GGSGQ--LSCTSGG------PGGSASSGSGGNGAIGPASMAPNSVAGDGSPAGG 476
               |::|.|. .|..|  ||.::.|      |..|..|..       |.:.:|:|.......|..
Mouse   345 EPEGEVGPPKINGETQPWLSTSTEGLKIPITPTSSFVSPP-------PPTASPHSNRTTPPEAAQ 402

  Fly   477 NGPS-------------GSNGS------------GGSVNPGPGSSGSQGGGGGGTPLASGGGSAG 516
            ||.|             ||:.|            ..|..|.|.|...:..|    |...||.:.|
Mouse   403 NGQSPMAALILVADNAGGSHASKDATQVHSTTRRNSSSPPSPSSMNQRRLG----PREVGGQATG 463

  Fly   517 S-GGLGGAPGSSAASNSAAAAAAAAAQNATLKCTLCQERLEDTHFVQCPSVNHHKFCFPCSRESI 580
            | |||.....:|...:|.||       :|.|.||||.||||||||||||||..|||||||||:||
Mouse   464 STGGLEPVHPASLPDSSLAA-------SAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSI 521

  Fly   581 KRQNGLGNEVYCPSGDRCPLANSVIPWAFMQGEITTILGEEVKVKKERES 630
            |:| |...|||||||::|||..|.:|||||||||.|||..:|||||||:|
Mouse   522 KQQ-GASGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKKERDS 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155 39/51 (76%)
zf-C3HC4 548..593 CDD:278524 36/45 (80%)
Irf2bp2NP_001158070.1 IRF-2BP1_2 12..63 CDD:288155 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84964016
eggNOG 1 0.900 E1_KOG3579
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 283 1.000 Inparanoid score I2839
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1156771at2759
OrthoFinder 1 1.000 FOG0005046
OrthoInspector 1 1.000 T615369
orthoMCL 1 0.900 OOG5_138345
Panther 1 1.100 O PTHR10816
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5742
TreeFam 1 0.960
1211.890

Return to query results.
Submit another query.