DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and IRF2BP1

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_056464.1 Gene:IRF2BP1 HGNCID:21728 Length:584 Species:Homo sapiens

Alignment Length:750 Identity:228/750 (30%)
Similarity:293/750 (39%) Gaps:298/750 (40%)


  Fly     5 TKRQHCYLCDLPRMPWAMINDFSEAVCRGCVNYEGADRIEAVLDAARQMKRLH----------PA 59
            ::||.|||||||:|||||:.||||||||||||:|||||||.::|||||:||.|          ||
Human     7 SRRQWCYLCDLPKMPWAMVWDFSEAVCRGCVNFEGADRIELLIDAARQLKRSHVLPEGRSPGPPA 71

  Fly    60 SKQQRSHENGEVSAAAAAAVVLQQQQQLQVGPVPGQGPGSHRGGGGGGPPGAPPGSGGPGPSGAG 124
            .|...:.:     .|||||                ||            |..||....|.|||.|
Human    72 LKHPATKD-----LAAAAA----------------QG------------PQLPPPQAQPQPSGTG 103

  Fly   125 SLSSLGNAVAAAAAAAAVHHHHQMPYQMPVPRIGPPLDYPV--KL------EDAPGGGVRPVRIS 181
            ...|..:....|.::.          ::|:|  .|.|:|.:  :|      |:|...|.|...:.
Human   104 GGVSGQDRYDRATSSG----------RLPLP--SPALEYTLGSRLANGLGREEAVAEGARRALLG 156

  Fly   182 HMTPHHLPPNATRGGGGAPGGGVPTAGSGGGSLPPALSVNLKRPPSEDV---DVDVSQQQQ---- 239
            .| |..:||       |.....|...||.|.:|.|.||      |:..:   |.:..:||:    
Human   157 SM-PGLMPP-------GLLAAAVSGLGSRGLTLAPGLS------PARPLFGSDFEKEKQQRNADC 207

  Fly   240 ---------------------------------------QSGHGL-----APDGSAGNSLSAGGG 260
                                                   :..|||     |.|.:|.        
Human   208 LAELNEAMRGRAEEWHGRPKAVREQLLALSACAPFNVRFKKDHGLVGRVFAFDATAR-------- 264

  Fly   261 VSGGCPPGIK---RSAMDDPSGVGG-----------------RPPLTRGESLPAA----VSYVPE 301
                 |||.:   :...:.|.|.|.                 |.|   |::|.::    :.|...
Human   265 -----PPGYEFELKLFTEYPCGSGNVYAGVLAVARQMFHDALREP---GKALASSGFKYLEYERR 321

  Fly   302 ------RQL-----SGLRDKQQPVRAPSFDASTFKAANPIPNPIPHHLHIAEHMSPASRRNGSSP 355
                  |||     .|:|..::|  ||         |..:|...|         .||.......|
Human   322 HGSGEWRQLGELLTDGVRSFREP--AP---------AEALPQQYP---------EPAPAALCGPP 366

  Fly   356 PS------GPLPPRSVHSPNSSGSSSGRRSS---GSRH-VSSTTVTSSEVGG-SNPGQAV--VAG 407
            |.      .|.|.|...||...|.::|:.::   ..|| |:.....|:|..| .:|..|:  ||.
Human   367 PRAPSRNLAPTPRRRKASPEPEGEAAGKMTTEEQQQRHWVAPGGPYSAETPGVPSPIAALKNVAE 431

  Fly   408 GLG-----GGGGGGPGSNAASGQLGGPSGGSGQLSCTSGGPGGSASSGSGGNGAIGPASMAPNS- 466
            .||     .||||||                    ..:||...:|||          .:..|.. 
Human   432 ALGHSPKDPGGGGGP--------------------VRAGGASPAASS----------TAQPPTQH 466

  Fly   467 --VAGDGSPAGGNGPSGSNGSGGSVNPGPGSSGSQGGGGGGTPLASGGGSAGSGGLGGAPGSSAA 529
              ||.:|.              ..|:|..|:....|||            :|:|...|||     
Human   467 RLVARNGE--------------AEVSPTAGAEAVSGGG------------SGTGATPGAP----- 500

  Fly   530 SNSAAAAAAAAAQNATLKCTLCQERLEDTHFVQCPSVNHHKFCFPCSRESIKRQNGLGNEVYCPS 594
                            |.||||:||||||||||||||..||||||||||.||.| |...||||||
Human   501 ----------------LCCTLCRERLEDTHFVQCPSVPGHKFCFPCSREFIKAQ-GPAGEVYCPS 548

  Fly   595 GDRCPLANSVIPWAFMQGEITTILGEEVKVKKERE 629
            ||:|||..|.:|||||||||.|||..::||||||:
Human   549 GDKCPLVGSSVPWAFMQGEIATILAGDIKVKKERD 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155 40/51 (78%)
zf-C3HC4 548..593 CDD:278524 36/45 (80%)
IRF2BP1NP_056464.1 IRF-2BP1_2 8..59 CDD:314247 40/51 (78%)
DNA_pol3_gamma3 <342..>463 CDD:331207 40/171 (23%)
vRING-HC_IRF2BP1 501..556 CDD:319629 44/56 (79%)
variant RING-HC finger (C3HC4-type) 503..552 CDD:319629 40/50 (80%)
Cys-rich 503..550 39/48 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85248745
eggNOG 1 0.900 E1_KOG3579
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I3106
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1156771at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T608544
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10816
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5742
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.