DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pits and MYT1L

Sequence 1:NP_001138192.1 Gene:Pits FlyBaseID:FBgn0030400 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_011508620.1 Gene:MYT1L HGNCID:7623 Length:1209 Species:Homo sapiens

Alignment Length:501 Identity:94/502 (19%)
Similarity:148/502 (29%) Gaps:160/502 (32%)


  Fly   223 KRPPSEDVDVDVSQQQQQSGHGLAPDGSAGNSLS---------------AGGGVSGGCPPGIKRS 272
            :|.|.:::::....:.::...|..||.:..:.|:               |......||     ..
Human   348 ERNPQQNMNIRQHVRPEEDFPGRTPDRNYSDMLNLMRLEEQLSPRSRVFASCAKEDGC-----HE 407

  Fly   273 AMDDPSGVGGRP-----PLTRGE--SLPAAVSYVPER---------QLSGLRDK------QQPVR 315
            ..||.:.|....     .:|:|.  .|..|::...||         ..:|.||.      |.|.:
Human   408 RDDDTTSVNSDRSEEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQ 472

  Fly   316 APSFD-------------------ASTFKAANPIPNP-----------IPHHLHIAEHMSPASRR 350
            .|..|                   :.|.|..:..|.|           .|||           |.
Human   473 LPGEDRKPKSSDSHVKKPYYGKDPSRTEKKESKCPTPGCDGTGHVTGLYPHH-----------RS 526

  Fly   351 NGSSPPSGPLPPR--SVH-------SPNSSGS---SSGRRSSGSRHVSSTTVTSSE--VGGSNPG 401
            ....|....:||.  ::|       :|..:|.   :|.|.|  .|.:|...:.::|  .......
Human   527 LSGCPHKDRVPPEILAMHESVLKCPTPGCTGRGHVNSNRNS--HRSLSGCPIAAAEKLAKAQEKH 589

  Fly   402 QAVVAGGLGGGGGGGPGSNAASGQLGGPSGGSGQLSCTSGG---------PGGSASS-------- 449
            |:....          .|:.||.::..|.....||.....|         |..:.:.        
Human   590 QSCDVS----------KSSQASDRVLRPMCFVKQLEIPQYGYRNNVPTTTPRSNLAKELEKYSKT 644

  Fly   450 ----GSGGNGAIGPASMAPNSVAGDGSPAGGN-------GPSGSNGSGGSVNPGPGSSGSQGGGG 503
                .|..|...|..::||.....|.||.|.:       .||.|:.|..|..|...|:       
Human   645 SFEYNSYDNHTYGKRAIAPKVQTRDISPKGYDDAKRYCKDPSPSSSSTSSYAPSSSSN------- 702

  Fly   504 GGTPLASGGGSAGSGGLGGAPGSSAASNSAAAAAAAAAQNATLKCTLCQERLEDTHFVQCPSVNH 568
                |:.||||:.|.....:.........||..||.|..|.:.:|....:.|         |...
Human   703 ----LSCGGGSSASSTCSKSSFDYTHDMEAAHMAATAILNLSTRCREMPQNL---------STKP 754

  Fly   569 HKFCFPCSRESIKRQNG---LGNEVYCPSGDRCPLANSVIPWAFMQ 611
            ...|...:.:....:||   |......|....||:...:.|.:..|
Human   755 QDLCATRNPDMEVDENGTLDLSMNKQRPRDSCCPILTPLEPMSPQQ 800

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PitsNP_001138192.1 IRF-2BP1_2 6..57 CDD:288155
zf-C3HC4 548..593 CDD:278524 7/48 (15%)
MYT1LXP_011508620.1 zf-C2HC 30..56 CDD:279824
zf-C2HC 505..531 CDD:279824 6/37 (16%)
zf-C2HC 549..575 CDD:279824 7/28 (25%)
MYT1 621..872 CDD:285648 41/201 (20%)
zf-C2HC 882..907 CDD:279824
zf-C2HC 925..951 CDD:279824
zf-C2HC 974..1000 CDD:279824
zf-C2HC 1027..1053 CDD:279824
Rota_VP2 1075..>1141 CDD:282884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85315088
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.