DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsp1alpha and PPO3

DIOPT Version :8

Sequence 1:NP_511138.2 Gene:Lsp1alpha / 32199 FlyBaseID:FBgn0002562 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_524760.1 Gene:PPO3 / 44513 FlyBaseID:FBgn0261363 Length:683 Species:Drosophila melanogaster

Alignment Length:740 Identity:178/741 (24%)
Similarity:293/741 (40%) Gaps:179/741 (24%)


  Fly    89 LPKGEFFGALVKHHAKQARGLFNFFYYAKDWETFMTNVAFARMHFNEGMFVYALTLAVIHRDDFH 153
            |.:.|.|...:|.|.|.|..|...|...:..:...:...:||...|..:|.|||::|::||.|..
  Fly    75 LGRSEQFSIFLKSHRKMASHLIEIFTKMQTVDELQSVAVYARDRVNPVLFNYALSVALLHRPDTK 139

  Fly   154 GLVLPAIHEIFPQFFFNSKFV--MEAEKFDYEMWMKTSLYEKEYMDVYHKIPTFSSYEHGYKQGM 216
            .|.|||..:.||..|.:||.:  |..|.|..|....             ::|..||.:       
  Fly   140 DLELPAFAQTFPDRFIDSKMLRSMREESFVVERSAA-------------RLPVVSSVK------- 184

  Fly   217 AYGYGKTHGHGQTYEHEFGSMYQTSDYMYMKDFKTWQWWKLMGLGEHWYSESNYILRENIYEYNQ 281
                                 |..||.                                      
  Fly   185 ---------------------YTASDL-------------------------------------- 190

  Fly   282 ESNWLTMMKDVKKFYMPVDYSRDLYLYNEESKLSYFTEDLGWNSYWYYLNMDYSFFLDGKTFGLQ 346
                     ||                  |.:|.||.||||.|.:.::.::.|......::. :.
  Fly   191 ---------DV------------------EHRLWYFREDLGVNLHHWHWHLVYPIEAPDRSI-VD 227

  Fly   347 NDRRGEWWLYNVHQLLSRYHMERLSHGLGEIPQFSWFHQ-IEMGYDPQL-IYYNGIGYSYRKNYY 409
            .|||||.:.|...|:::||:.||||:.:..:..|:...: |..||.|:: .......|..|.:..
  Fly   228 KDRRGELFYYMHQQIIARYNAERLSNHMARVQPFNNLDEPIAEGYFPKMDSLVASRAYPPRFDNT 292

  Fly   410 ELETYG--NFEM---LDKITGFQQRIQNIVELGYYQTTDGHMIDLRKPESIEIIGNMLQGNVDAI 469
            .|....  |.::   :|.:..:::||...:..||...|:...|.|...:.|:|:||:::.:....
  Fly   293 RLSDVDRPNNQLRVGIDDMKRWRERIYEAIHQGYVLDTNNEKIVLDDAKGIDILGNIIEASDLTP 357

  Fly   470 DNIFFQFWYMLAHMYFADTH---YYQMEVYPNVMLNFETMMRDPMFYMFYKSIAQVYFQFMHHLP 531
            ::..:..::.:.|:..|.:|   ...:| |..||.:..|.||||:||.::..|..::.:....|.
  Fly   358 NSTLYGDFHNMGHILIAYSHDPTNKHLE-YAGVMGDASTAMRDPIFYKWHAFIDNMFQEHKRLLS 421

  Fly   532 KYTKEQLLMPGVTLKHV------EVSELVTYFDLVDFDVTNMLNGKMVFHEGQFLWDKSLFARQM 590
            .|.|::|..|.|.::.:      :|:.|.|::...|.|::..|:         |:....:.||..
  Fly   422 PYEKQELSFPDVRVESIQVESQGQVNRLTTFWQESDVDMSRGLD---------FVPRGHVLARFT 477

  Fly   591 RLNHKPFSYTYTIDSARD--EKVVIRAFLGPKFDEYGRMISLTDNRMNFMEIDEFTYTLKTGSNL 653
            .|.|..||||..::::.:  ....:|.||.||.|:....:.|...|:..:|:|:|..|:..||:.
  Fly   478 HLQHHEFSYTIKVENSSEATRYGYVRIFLAPKLDDRNAPMLLEQQRLMMVELDKFVVTMPPGSHT 542

  Fly   654 ITRKSTDFAWTVKDRTTYTELYYYTMMAFDGKYDYPLDLTEP------HCGFPDRLVLPMGWKKG 712
            |||.||:.:.|:....|:..                ||..|.      .||:|..:::|.|..:|
  Fly   543 ITRNSTESSVTIPFERTFRN----------------LDKLEELQNFLCGCGWPQHMLIPKGRPEG 591

  Fly   713 MPMQMFFMVVPYMAPQHEQFSTFDYTYSCGIGSGARHV--------DSLPFGYPFDR------EI 763
            :..::|.||..|     |:.........||....|.:.        |....|:||||      ||
  Fly   592 LRFELFVMVSNY-----EEDKVDQTVADCGCSIAASYCGLRDRLYPDRKSMGFPFDRKPRRGSEI 651

  Fly   764 NEYEFHVPNMYFKDVTIYHADTMEK 788
            .| .|..|||...:|.|.|.|..||
  Fly   652 LE-NFLTPNMCAVEVIITHEDRTEK 675

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lsp1alphaNP_511138.2 Hemocyanin_N 32..154 CDD:281684 20/65 (31%)
Hemocyanin_M 287..523 CDD:278784 61/246 (25%)
Hemocyanin_C 532..782 CDD:281685 73/278 (26%)
PPO3NP_524760.1 Hemocyanin_N 19..140 CDD:281684 20/65 (31%)
Hemocyanin_M 150..413 CDD:278784 76/371 (20%)
Hemocyanin_C 422..669 CDD:281685 73/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C310625887
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11511
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.