DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and RABA2c

DIOPT Version :10

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_190267.1 Gene:RABA2c / 823836 AraportID:AT3G46830 Length:217 Species:Arabidopsis thaliana


Alignment Length:66 Identity:13/66 - (19%)
Similarity:25/66 - (37%) Gaps:16/66 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 MNVTEVPNWLIMFAHFTWEFIHGAPVFIYLALNRMIRERFLEKMHWMKGGALRETTSMMPIKKSV 324
            :||..:|.|....|                :|:|.:..:.|::|.....|.::...|...:.:|.
plant   429 LNVNNLPEWSASSA----------------SLHRSLSPQLLQQMQNNPNGTVKTIGSYAQVPRSR 477

  Fly   325 S 325
            |
plant   478 S 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop containing Nucleoside Triphosphate Hydrolases 6..265 CDD:476819 2/4 (50%)
SOCS 192..234 CDD:470605
RABA2cNP_190267.1 PLN03110 1..217 CDD:178657
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.