DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab40 and Rab3

DIOPT Version :10

Sequence 1:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523687.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster


Alignment Length:170 Identity:59/170 - (34%)
Similarity:95/170 - (55%) Gaps:13/170 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCS--GNDCTSHILQTVAYKTTTILLEGKRV 68
            :::||:.|:|::|:|.|||...|....|.|..|.|.|  |.|          :|..|:....|||
  Fly    16 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGID----------FKVKTVFRHDKRV 70

  Fly    69 KLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVGNR 132
            |||:|||:||.|:.||..:|.|||.|.||:||:||:.||:.:..|:.::..:: .....:||||:
  Fly    71 KLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNK 135

  Fly   133 LHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESF 172
            ..:..:|.::.::....|.:..:..||.|...|.|::..|
  Fly   136 CDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab40NP_727611.1 P-loop containing Nucleoside Triphosphate Hydrolases 6..265 CDD:476819 59/170 (35%)
SOCS 192..234 CDD:470605
Rab3NP_523687.1 Rab3 21..185 CDD:206657 57/165 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.