DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15731 and Zmat1

DIOPT Version :8

Sequence 1:NP_572799.1 Gene:CG15731 / 32194 FlyBaseID:FBgn0030390 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006227508.1 Gene:Zmat1 / 308654 RGDID:1565344 Length:663 Species:Rattus norvegicus

Alignment Length:92 Identity:18/93 (19%)
Similarity:30/93 (32%) Gaps:35/93 (38%)


  Fly     1 MKIFVCLLATLAATASAGFIGGSGGGGGGGHQEVKTIQVIHQEGGGYSGGGGHGGYSGGHGGYSG 65
            |:.:||.:.::..|:...|....    .|...::|...||:|                       
  Rat   193 MRTYVCHICSITFTSLHMFRSHM----QGTEHQIKESHVINQ----------------------- 230

  Fly    66 GGHQEIKTIKVIQQEGGGYSGGHGGYS 92
                 :|..|.:|:   .|.|..|.||
  Rat   231 -----VKNSKKMQE---SYQGECGDYS 249



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28M81
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.