DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ten-a and Ten-m

Sequence 1:NP_001162732.2 Gene:Ten-a FlyBaseID:FBgn0267001 Length:3387 Species:Drosophila melanogaster
Sequence 2:NP_001262211.1 Gene:Ten-m FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster

Alignment Length:3569 Identity:1114/3570 (31%)
Similarity:1729/3570 (48%) Gaps:729/3570 (20%)


  Fly     1 MSSSHSGTIGRKR-VGSGSAAGSEYYYASGGLGGLTGSSNGGGNGGGEQLRRQRSAEWHSHGRHG 64
            :|..|:.::..|. .|.|.|.|      ..|||     :.|.|:|||.......:|..:|     
  Fly   285 LSKLHNSSVRAKNGQGIGLAQG------QSGLG-----AAGVGSGGGSSAATVTTATSNS----- 333

  Fly    65 HGHGLSHGMGHGMGHGYGSSSEDEYQNTGQATAFDTQLLAQLLLQSQQLASMEH----YNSDCEP 125
                       |...|..|:|......:..||:.....|...|  |..||:..:    .::....
  Fly   334 -----------GTAQGLQSTSASAEATSSAATSSSQSSLTPSL--SSSLANANNGGRAMSTRLSV 385

  Fly   126 DYLRQRDRHHEEATPLGDGTPTVTAAAPEVTYAQPHQQRSTMPAGSPLKVSTVSAGKYQSNANLG 190
            ....:|.|.|..:.....|...|   |.:.|::......|         ::..:|.||.: ..|.
  Fly   386 RGAGERGRRHRRSLNEEQGEDDV---ATDGTFSDLITNES---------LNQQAAEKYLA-TTLA 437

  Fly   191 LFPNSSSSGGSSV---QNGV-----TAHTPRS-------------TNPFLNGSTKFASDDGGLEN 234
            ..|......|:..   .:||     :..||.:             |.|.|...||.....|...|
  Fly   438 KSPTDVHGSGNKTLPRMDGVYGTQRSEDTPDTSYDYVYEDEVEPETTPSLIRRTKTGQQFGKSLN 502

  Fly   235 INMLKPSASSSTAASSSIRSSHRNRNALNRLSGMTSSSSDSQTHHHQQQQQQQQQQQQQQQQQQL 299
            .|:   .:::.|..:...:..|                ...:..|.:.::::::.:|:.::.:.:
  Fly   503 SNL---RSAAKTLVNKRRKYDH----------------GTVEAEHIKHEEEEEEDEQKLERHEAI 548

  Fly   300 QISQQQQQQIAAVKQQQQMLPP--EDSGDDDFVLGLGSLELGNCSSGGESEEPPPEPAP------ 356
            .::.:     ...:.:...||.  :|....|           |.|||     |.||...      
  Fly   549 GMATE-----LTTESETSTLPAVIDDDNQSD-----------NSSSG-----PTPETTVRSDTDD 592

  Fly   357 -PEI---PPRTQSLLMSLRKHS-----DYKLKYEEKGDQKHEEFIP-TSQLQKDYILSDNLRSDQ 411
             .||   |.:|.....:...|.     |:::|..:.|..:.|:  | |..:..:..|:||...|.
  Fly   593 IVEINTPPSQTAQRTFAAVSHQPAIEHDFQIKGTDAGGLQTEK--PATDDINNERDLADNYEVDS 655

  Fly   412 QLKPISPGDSNGLGGHPQQMPQSMSTGS--------------NTIGH-GGIDRGGVGLPMGAGTM 461
            : :|.|||.       |.|...|..||.              |...| ..||         ...:
  Fly   656 K-EPTSPGT-------PPQGKVSQQTGKASLQSLQSESDLMMNDASHYEDID---------IVKL 703

  Fly   462 PGGVGGGPGGVAGGGPQVGVGPPGSGNGGNCQISGSQPLVMPGFPLRNSHSAHAPHYSPYSPSRF 526
            .|........:.....:..:.|.   |..:..|..||..|:.|....:..........||...|.
  Fly   704 DGLTISHEEEIYKTADKENMAPK---NQPSQHIDRSQNEVLKGHQQGDEKQPQLEPLKPYVSERV 765

  Fly   527 HI-DKRCQHRCSWKCLSIALIFVSVVLTAMLAYFAAVSSMKPNMDSTNCILVQ-DVKSQPHDLRG 589
            .: .||              ||:::.:           :.....||...:.|: .....||.::.
  Fly   766 DLPGKR--------------IFLNLTI-----------ATDEGSDSVYTLHVEVPTGGGPHFIKE 805

  Fly   590 GLAKSNEKGVATA-----------------------------------FPTEESIQTSTSDHGQN 619
            .|  ::||..|.|                                   .|..:::.|||..    
  Fly   806 VL--THEKPTAQADSCVPEPPPRMPDCPCSCLPPPAPIYLDDTVDIDSAPPAKTVTTSTIS---- 864

  Fly   620 GHGLMNP-SAGSGGSNSGIQQQLLLQQQQPHS---INQPLTPLDATNTHLQDHHQLTYGGALPG- 679
              ..:|| .:.......|::.    ::|.|.|   .|.|.|.:|   .|:....:       |. 
  Fly   865 --APINPFHSEEEDDEDGVRD----EEQTPSSSTATNLPSTEID---NHIAAFTE-------PAV 913

  Fly   680 GVGGIGMSGGGIM------------------NGGLNG--GLGGQLMQQPGGGLNGHHHQALQPQL 724
            |.||:..:...:|                  :|...|  .||.:|.::            :||  
  Fly   914 GAGGVPFACPDVMPVLILEGARTFPARSFPPDGTTFGQITLGQKLTKE------------IQP-- 964

  Fly   725 GGVVELKEFNEAYHATIPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFV 789
                               |.:|.::|....||:::|::|:|.||...||.|||..|:.||:.|.
  Fly   965 -------------------YSYWNMQFYQSEPAYVKFDYTIPRGASIGVYGRRNALPTHTQYHFK 1010

  Fly   790 EFIKGGRLDSHLRHRRSSANATTTGQDMELYRQDKDQSAESAQDQDSEQDESRSFDSSESYDVET 854
            |.:.|             .:|:|             ::|.:|                       
  Fly  1011 EVLSG-------------FSAST-------------RTARAA----------------------- 1026

  Fly   855 PLDTAKQHLQRIGKPQSHWVNKRSAGDGLPALDVDAMTVNVSLLQYLDTGLWFISVYNDELVAHS 919
                   ||                            ::...:.:|::.|.||:|:|||:.....
  Fly  1027 -------HL----------------------------SITREVTRYMEPGHWFVSLYNDDGDVQE 1056

  Fly   920 VSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDCIDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEE 984
            ::..|..||.::..|||.|||.|.|.||.|.|..|:.|.|||:||||||||.||.|..|.|.|..
  Fly  1057 LTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNP 1121

  Fly   985 GWKGAECDIPVGECEVPNCSSHGRCIEGECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCK 1049
            ||||.||.:...||||.:||.||.|:.|:|.|.||:||.:|::.||..|.|||||.|..|.|.||
  Fly  1122 GWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCADGTCICK 1186

  Fly  1050 AGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGK 1114
            .||:|.||.|:||...||||.||.|||:||:|..|.||..|:|.|||:.:|.||||::|.||...
  Fly  1187 KGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCEGDA 1251

  Fly  1115 CRCNSGWTGNLCDQLPCDSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLE-NGE 1178
            |.|:..|.|..|:...||.||:||||||||||:|..||||:|||:.||.|.|:.||||.:. .|:
  Fly  1252 CACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQ 1316

  Fly  1179 YRCDCIEGWAGRDCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLR 1243
            :.|.|.|||.|.||.|||||||.|:.|||.||:.||.|.|||:...|....:|:|:..|::||||
  Fly  1317 WECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKTSQLCVSAPKPIDVLLR 1381

  Fly  1244 KQPPSVTASFYQRVKFLIEENSVQSYAHMDEYSENLFWSSFTPCRVSVMRGQVITPQGLGIVGIR 1308
            ||||::||||::|:||||:|:|:|:||.::.::|::||:.|...|.:|:||:|:|..|:|:||:|
  Fly  1382 KQPPAITASFFERMKFLIDESSLQNYAKLETFNESIFWNYFNASRSAVIRGRVVTSLGMGLVGVR 1446

  Fly  1309 VSVDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQLSD 1373
            ||...... ||||||..||||::|||||||||||.|:||||.:|.|.||||.:|::..|.|.:|:
  Fly  1447 VSTTTLLE-GFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRPQSRIVQVPWNEVVIIDLVVMSMSE 1510

  Fly  1374 DDETTSRNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMPNGVGAMPG 1438
            :     :.:.|...            ||          |..||::.::|.::::|.....||.|.
  Fly  1511 E-----KGLAVTTT------------HT----------CFAHDYDLMKPVVLASWKHGFQGACPD 1548

  Fly  1439 KRVIFAETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALH 1503
            :..|.||:|::|||:||||:.|:|.|.||:|:||||.::::||.:.||.:|..:|:.:.|||.|.
  Fly  1549 RSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIHLRITIEGILF 1613

  Fly  1504 VKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPVWIAQTAKLQGYDVDISDI 1568
            .:.:||||.:..|:|||:.|:|||:|||||.|.:.||||::.|...||..||.||.|:|:.||::
  Fly  1614 ERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDIVWDIQTTKLSGHDMSISEV 1678

  Fly  1569 GGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTGLQRPLTCPDYCNGVAKDAKLLTP 1633
            |||.|||||.||||||||||||||.::::..||.:...||.|.||||.||| |:|.|...:||.|
  Fly  1679 GGWNLDIHHRYNFHEGILQKGDGSNIYLRNKPRIILTTMGDGHQRPLECPD-CDGQATKQRLLAP 1742

  Fly  1634 IALATGPDGSLYVGDFNLVRRITPDGKVYTILQLSATQVSYQYYLAVSPADGHLYISDPERHQIL 1698
            :|||..|||||:|||||.:|||..||.:.|:::|:||:|||:|::|:||.||.||:||||.|||:
  Fly  1743 VALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQII 1807

  Fly  1699 RLVRLEKVKDPSINSDPVVGSGQRCIPGDEGNCGDGGPALLARLSHPKGLAIAADRTMYIADGTN 1763
            |:........|.:|.:.|||||:||:||||.:||||..|..|:|::|||:||::|..:|.|||||
  Fly  1808 RVRDTNDYSQPELNWEAVVGSGERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTN 1872

  Fly  1764 IRAVDPKGVIHTLIGHHGHHNHWSPAPCSGTLMANQAQLQWPTGLALSPLDGSLHFIDDRLVLRL 1828
            ||.||..|::.||||:|.|.:||.|.||.|||...:..|:|||.||:||:|.:||.|||.::||:
  Fly  1873 IRMVDRDGIVSTLIGNHMHKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRM 1937

  Fly  1829 TSDMKIRVVAGTPLHCSNGGQDGRVNKTGADNVLGT--VLAM----AFSPFGNLYIADSDSRRVN 1887
            |.|.::||::|.||||:..       .|..|..|.|  .|.|    ||.|.|.||:|:|||:|:|
  Fly  1938 TPDGRVRVISGRPLHCATA-------STAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRIN 1995

  Fly  1888 SIRVVDTAGNMRYFAGKQEGTGSQTCDCAIGGGSNGSATNSGVGGAGGSAYSTTVNPTRPNGGTT 1952
            .:||:.|.|.:..|||.:     ..|:|...|                                 
  Fly  1996 RVRVIGTDGRIAPFAGAE-----SKCNCLERG--------------------------------- 2022

  Fly  1953 PTTPSGGNGNGNGNGSSATSSGGSVGGSNGSGGGANGGACICAGGIALSTGTGSSSGSNGGGTLA 2017
                                                   |.|                       
  Fly  2023 ---------------------------------------CDC----------------------- 2025

  Fly  2018 SIVGSGGLMSTGPTTTTTVLLGAKTTAAGIGAATLNDDGTLSNAETLLSSNARFQAISAIAVAQD 2082
                                                     ..||..|:::|:|..|:|:||..|
  Fly  2026 -----------------------------------------FEAEHYLATSAKFNTIAALAVTPD 2049

  Fly  2083 GVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSSEIYVFNRYGQHVATKDLTSGKTRYSFLY 2147
            ..:::|||.:..:.::...:|....:.|:.|..|...|||:|||:||||:|:::.:|:|.|.|.|
  Fly  2050 SHVHIADQANYRIRSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTY 2114

  Fly  2148 SKNTSFGRLSTVTDASGNKIQFLRDYSNVVSSIENTQDHKSEIQINGIGIMTKLSEKGRQEIELD 2212
            :.|||.|:|||||||:|||:..||||::.|:|||||:..|..:::..:.::.:||......:..:
  Fly  2115 NVNTSNGKLSTVTDAAGNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYE 2179

  Fly  2213 YDSNTGLLNSR-SSGGETYIYQYDEFGRVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFS 2276
            |...||||.:: .|.|.:|:|.||||||:|..:.|:|.::.::..|: .:|..|.|..:.:...|
  Fly  2180 YHGPTGLLRTKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLS-VKGAQVKVSENAQKEMS 2243

  Fly  2277 RERIAGEANELLVLGGVRSTFLKRGQAHA--DAELKANNTLVIHGDNGVVVEAS----AVARHPL 2335
                      ||:.|.  :..::.|.|.:  ..::..:.|.:....:.:.:|.:    ...:.||
  Fly  2244 ----------LLIQGA--TVIVRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPL 2296

  Fly  2336 LEAALPVEAEMLAMWSHQSVTMGEGLTNSMYSVYSLVGDVRN----------------------- 2377
            |..:.||.|:...                     .:.||:.|                       
  Fly  2297 LGESYPVPAKQRT---------------------EIAGDLANRFEWRYFVRRQQPLQAGKQSKGP 2340

  Fly  2378 --PQQTLNREIWVNQSRVIGVEFDQFTNRETFYDARRTPILIVAYDQSGLPKSYYPTNG--YPVN 2438
              |...:.|::.||...|:.:|:|:.|.........:..:|.|.||::..|.|:.|.:|  ..|:
  Fly  2341 PRPVTEVGRKLRVNGDNVLTLEYDRETQSVVVMVDDKQELLNVTYDRTSRPISFRPQSGDYADVD 2405

  Fly  2439 ITYDRFNRVEGWAWGPAELKYSYDRHGLLSEITSQQDGIVSFVYNDW--NLVSEIGLASQRKFVL 2501
            :.||||.|:..|.||..:..||:||:|.|:||.......:.:.:.|.  :|..::....:..::|
  Fly  2406 LEYDRFGRLVSWKWGVLQEAYSFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLL 2470

  Fly  2502 QYDDAGGLRHVVLPSGTRHSFSMQTSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARI 2566
            ||||||.|:.:..|.|..|:||:|||:||.:..|..|.:...:...|:..|.:|..|.|....::
  Fly  2471 QYDDAGALQSLTTPRGHIHAFSLQTSLGFFKYQYYSPINRHPFEILYNDEGQILAKIHPHQSGKV 2535

  Fly  2567 VYRYNAAGQLTEVVHGDGRSEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKT 2631
            .:.::.||:|..::.|...:.:.|.:.|.:..:|...|...|.|.:|:|.||:|.:|::.:.:|.
  Fly  2536 AFVHDTAGRLETILAGLSSTHYTYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKN 2600

  Fly  2632 GLSNAKFSYEYDSQLRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGT 2696
            .|::|::.|.||...|:..::..|..:.|||..:.|....|:..::...:.::.|.|:|.:.|..
  Fly  2601 SLASARYKYAYDGNARLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSA 2665

  Fly  2697 ASFTRTVD----GRFQTQRMALAIHRLEVFRMEFSYGVHGRI-SQTRTYTRNMAVNSYTNVKNYT 2756
            ..|...||    ||.::  :.:.:..::|||:|..|.:..|| ||..|:.|:.|.:..    || 
  Fly  2666 KQFFAIVDYDQHGRVKS--VLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRSTAFDKI----NY- 2723

  Fly  2757 WDCDGQLVGVEAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQY-KYDARGLVAQ 2820
             :.||.:|.|.....|.:.:|:|||.:.:..:|....:.|:..||::|.|:.:: .|||||.|.:
  Fly  2724 -NADGHVVEVLGTNNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVVK 2787

  Fly  2821 NAREERFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTNQQRPYEVSQIYS 2885
            .. |:::.||.:|.|:.:.:|.||...||||...||....||.||.||::|.|.:.|:.|:.::.
  Fly  2788 RG-EQKYRYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQYYYANPRTPHLVTHVHF 2851

  Fly  2886 PRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGIREIMRSPFGHIVYDSNP 2950
            |:..:.|.|.|||...||..:....:|||||||:|:||..|:|.|..::|:.|:|||.|:.|:.|
  Fly  2852 PKISRTMKLFYDDRDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKDTKP 2916

  Fly  2951 YLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRVAERIITPTRLHLYRFNGNDPIN 3015
            ..::||||.||::|..|.||:. :.|.|||.:||||:|.|:.:|..:..||.:.:||::.|||||
  Fly  2917 EFFVPIDFHGGLIDPHTKLVYT-EQRQYDPHVGQWMTPLWETLATEMSHPTDVFIYRYHNNDPIN 2980

  Fly  3016 VGHERHYPEDFAAWMRTLGYNVGNL----VPQLARDLWQPPALWGRPPANPVALNLRRPFDNIPT 3076
            ....::|..|..:|::..||::.|:    ..:||:  :.|.|   ...:|.:|          |.
  Fly  2981 PNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKLAQ--YTPQA---SIKSNTLA----------PD 3030

  Fly  3077 MAVESGF--LAHLNVRRMSDFEQLSAPPRSALKCDVMDPSPKTI---GSDTEPPFGKGIVVSRTA 3136
            ..|.||.  :......:.|||:.:   |:..||   |:|..:.:   .|.....||:|:::||..
  Fly  3031 FGVISGLECIVEKTSEKFSDFDFV---PKPLLK---MEPKMRNLLPRVSYRRGVFGEGVLLSRIG 3089

  Fly  3137 DGQAIVSSVPAANAIYRDVYTSVFNRSKLLPFTFVVHNAQQDSFFFVKEDAWRATEDRQQLKRLQ 3201
             |:|:||.|..:|::.:||.:||||.|..|...|.:|:  ||.|:|||::..:..:|.::|:||.
  Fly  3090 -GRALVSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHD--QDVFYFVKDNVLKLRDDNEELRRLG 3151

  Fly  3202 GQVNTTFHEITREATVGSGPAGAANGGAGSSSSSSSSSGGGSSSNTGNYLDVKIHGAHAIINLRY 3266
            |..|.:.|||                          |..|||::.     ::::||..|::.::|
  Fly  3152 GMFNISTHEI--------------------------SDHGGSAAK-----ELRLHGPDAVVIIKY 3185

  Fly  3267 GTTVAKEQQRLMHHAKLTAVRKAWHREKEALRSGLTTALEWSQQETDEILKQSYANNYEGEYIHD 3331
            |....:|:.|::.||...||.:||..||:.:.:|.....:|:::|.:|:::....:.:.|..||.
  Fly  3186 GVDPEQERHRILKHAHKRAVERAWELEKQLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHS 3250

  Fly  3332 VNLYPELAEDPYNIKF---VKKKGATGGAAGVPNSRRRRRRSTDL---IQEEEEELHRE 3384
            ::.||:||:||.|:.|   .|:|....|::....|.||:.:..:|   ::...|:|..|
  Fly  3251 IHKYPQLADDPGNVAFQRDAKRKRRKTGSSHRSASNRRQLKFGELSAXVEAYREKLVAE 3309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ten-aNP_001162732.2 EGF_2 934..960 CDD:285248 15/26 (58%)
Keratin_B2 998..1162 CDD:279797 93/164 (57%)
EGF_2 <1003..1025 CDD:285248 12/22 (55%)
EGF_2 1032..1057 CDD:285248 15/25 (60%)
EGF_2 <1071..1095 CDD:285248 14/24 (58%)
EGF_2 1101..1126 CDD:285248 11/25 (44%)
EGF_2 <1135..1157 CDD:285248 17/22 (77%)
EGF_CA 1163..1192 CDD:238011 14/30 (47%)
NHL 1622..1927 CDD:302697 150/311 (48%)
NHL repeat 1675..1721 CDD:271320 23/46 (50%)
NHL repeat 1745..1787 CDD:271320 25/42 (60%)
NHL repeat 1802..1847 CDD:271320 25/45 (56%)
NHL repeat 1864..1897 CDD:271320 19/39 (49%)
RHS_repeat 2213..2250 CDD:283287 18/38 (47%)
RhsA 2397..2958 CDD:225750 184/571 (32%)
Rhs_assc_core 2939..3015 CDD:274730 35/76 (46%)
Tox-GHH 3274..3349 CDD:292269 24/78 (31%)
Ten-mNP_001262211.1 TNFRSF 1069..1198 CDD:304602 73/129 (57%)
CRD2 1106..1151 CDD:276900 24/45 (53%)
EGF_2 1139..1162 CDD:285248 12/23 (52%)
Keratin_B2 1162..1330 CDD:279797 93/168 (55%)
EGF_2 1167..1194 CDD:285248 16/27 (59%)
DUF3844 1171..>1235 CDD:289707 38/64 (59%)
EGF_2 <1272..1294 CDD:285248 17/22 (77%)
NHL 1750..2065 CDD:302697 156/463 (34%)
NHL repeat 1784..1830 CDD:271320 23/46 (50%)
NHL repeat 1854..1888 CDD:271320 21/34 (62%)
NHL repeat 1911..1950 CDD:271320 21/39 (54%)
NHL repeat 1972..2005 CDD:271320 17/33 (52%)
NHL repeat 2039..2065 CDD:271320 8/26 (31%)
RHS_repeat 2183..2218 CDD:283287 17/35 (49%)
RhsA 2347..3020 CDD:225750 224/685 (33%)
YD_repeat_2x 2795..2836 CDD:273728 19/41 (46%)
Rhs_assc_core 2905..2980 CDD:274730 35/76 (46%)
Tox-GHH 3193..3268 CDD:292269 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75005637
eggNOG 1 0.900 E1_KOG1225
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 786 1.000 Inparanoid score I260
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000499
orthoMCL 1 0.900 OOG5_128674
Panther 1 1.100 P PTHR11219
RoundUp 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.