DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HOXB8 and unpg

Sequence 1:NP_076921.1 Gene:HOXB8 HGNCID:5119 Length:243 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:144 Identity:43/145 (30%)
Similarity:64/145 (44%) Gaps:36/145 (25%)


Human    78 CHGD----------PGNFYGYDPLQRQSLFGAQDPDLVQYADC-------KLAAASGL-GEEAEG 124
            |.||          |.|:.|.....|...:...|.:     ||       ......|: |::::|
  Fly   251 CSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSE-----DCSDDEGAQSRHEGGGMGGKDSQG 310

Human   125 SEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQ 189
            :..|.:             :..||.|..::..|.||||:||....||:...|.:::.:|.|:|.|
  Fly   311 NGSSSN-------------SKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQ 362

Human   190 VKIWFQNRRMKWKK 203
            |||||||||.|||:
  Fly   363 VKIWFQNRRAKWKR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 0/5 (0%)
Homeobox 150..203 CDD:333795 27/53 (51%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.