DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and UCH2

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_564858.1 Gene:UCH2 AraportID:AT1G65650 Length:330 Species:Arabidopsis thaliana

Alignment Length:326 Identity:138/327 (42%)
Similarity:199/327 (61%) Gaps:32/327 (10%)


  Fly    24 NWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKW----LDDKPAGRV 84
            :||.||||||||||:|......|.:|||::|:.:|:..:|.|::||||||||    .|::|   .
plant     2 SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDSDSLNNLRPVYGLIFLFKWQAGEKDERP---T 63

  Fly    85 VTDR-SDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLANEE 148
            :.|: |::|||.|||.|||||||:|.:|||  ..::|:|..|:.|:...::...:.:|..:.|.:
plant    64 IQDQVSNLFFANQVINNACATQAILAILLN--SPEVDIGPELSALKEFTKNFPSDLKGLAINNSD 126

  Fly   149 KIRKVHNSFARPELFVVEESTDFI-EDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQ--- 209
            .||..||||||||.||.||..... :||.|||:.::|:.|.|:||||:.||||.|......|   
plant   127 SIRAAHNSFARPEPFVPEEQKAATKDDDVYHFISYIPVDGVLYELDGLKEGPISLGPCPGDQTGI 191

  Fly   210 NWLDVVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQL----------SHAD 264
            .||.:|:|:|:.|:||||..||.|||:|::.:|:..|..:::.|.....||          |.|:
plant   192 EWLQMVQPVIQERIERYSQSEIRFNLLAVIKNRKDIYTAELKELQRQREQLLQQANTCVDKSEAE 256

  Fly   265 R-QAEIANLRSHVR-------HEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKA 321
            . .|.||.:.|.:.       .|:||..::|.|||||:|||:||:...||.|.|..||..:.:||
plant   257 AVNALIAEVGSGIEAASDKIVMEEEKFMKWRTENIRRKHNYIPFLFNFLKLLAEKKQLKPLIEKA 321

  Fly   322 K 322
            |
plant   322 K 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 104/222 (47%)
UCH2NP_564858.1 Peptidase_C12_UCH37_BAP1 3..220 CDD:187738 104/222 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I827
OMA 1 1.010
OrthoDB 1 1.010 D1363547at2759
OrthoInspector 1 1.000 T32133
orthoMCL 1 0.900 OOG5_128387
Panther 1 1.100 O PTHR10589
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.