DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and UCH1

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_197135.1 Gene:UCH1 AraportID:AT5G16310 Length:334 Species:Arabidopsis thaliana

Alignment Length:337 Identity:118/338 (35%)
Similarity:188/338 (56%) Gaps:47/338 (14%)


  Fly    24 NWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWLDDKPAGRVV--T 86
            :|..:|||||:|||:|......|.:|||::|:..::...:.|::|||.|:||..::...|||  .
plant     2 SWLPVESDPGIFTEIIQQMQVKGVQVEELYSLDFNSLDEIRPVYGLILLYKWRPEEKENRVVITE 66

  Fly    87 DRSDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLANEEKIR 151
            ...:.|||.|:|.|||||||:|.:|:|  ...||:|..|::|:...::..||.:|..:.|.|.||
plant    67 PNPNFFFASQIINNACATQAILSVLMN--SSSIDIGSELSELKQFAKEFPPELKGLAINNNEAIR 129

  Fly   152 KVHNSFARPELFVVEESTDFI-------EDDCYHFVGFMPIKGKLFELDGMHEGPIELADI---D 206
            ..||:||||:...:.|..:..       :||.||::.::|:.|.|:||||:.||||.|...   .
plant   130 AAHNTFARPDPSSIMEDEELAAAKNLDEDDDVYHYISYLPVDGILYELDGLKEGPISLGQCLGEP 194

  Fly   207 QQQNWLDVVRPIIEARMERYSVGEIHFNLMALVSDRQRCY-----------ERKIQMLVNLPSQL 260
            :...||.:|:|:::.:::|||..||.|:|:|:|.:|:..|           ||.:|.|..|    
plant   195 EGIEWLRMVQPVVQEQIDRYSQNEIRFSLLAVVKNRKEMYVAELKEYQRKRERVLQQLGAL---- 255

  Fly   261 SHADRQAE-----------------IANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQL 308
             .||:.||                 |..:...:..|:||.:.::|||:||:|||:||:...||.|
plant   256 -QADKYAEKSSYEALDRELSEVNIGIETVSQKIVMEEEKSKNWKKENMRRKHNYVPFLFNFLKIL 319

  Fly   309 GETGQLMAICDK 320
            .:..:|..:..|
plant   320 ADKKKLKPLIAK 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 87/225 (39%)
UCH1NP_197135.1 Peptidase_C12_UCH37_BAP1 3..226 CDD:187738 87/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I827
OMA 1 1.010
OrthoDB 1 1.010 D1363547at2759
OrthoInspector 1 1.000 T32133
orthoMCL 1 0.900 OOG5_128387
Panther 1 1.100 O PTHR10589
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.