DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and BAP1

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_011532451.1 Gene:BAP1 HGNCID:950 Length:752 Species:Homo sapiens

Alignment Length:308 Identity:103/309 (33%)
Similarity:168/309 (54%) Gaps:44/309 (14%)


  Fly    25 WCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWLDDKPAGR----VV 85
            |..:|||||:||.::..||..|.:||||:.:::   :...|::|.||||||::::.:.|    :|
Human     5 WLELESDPGLFTLLVEDFGVKGVQVEEIYDLQS---KCQGPVYGFIFLFKWIEERRSRRKVSTLV 66

  Fly    86 TDRS--------DIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGH 142
            .|.|        ::|||.|:|||:|||.|||.:|||.  ..:|||.||:.:::..:...||.:|:
Human    67 DDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNC--SSVDLGPTLSRMKDFTKGFSPESKGY 129

  Fly   143 RLANEEKIRKVHNSFARPELFVVEESTDFIED----DCYHFVGFMPIKGKLFELDGMHEGPIELA 203
            .:.|..::.|.|||.||||...:.|..:.:..    :.:|||.::||.|:||||||:...||:..
Human   130 AIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHG 194

  Fly   204 DIDQQQNWLDVVRPIIEARMERYSVGE----IHFNLMALVSDRQRCYERKIQMLVNLPSQLSHAD 264
            ...:.:.|.|..|.:|..|:...:.||    |.|||||:|.||:..||.::.:|        ..:
Human   195 PWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYEARLHVL--------KVN 251

  Fly   265 RQAEIANLRSHVR---------HEKEKKRRYRKENIRRRHNYLPFIVE 303
            ||..:..|:..:|         |:.::.:  ..|..:...|..|.::|
Human   252 RQTVLEALQQLIRVTQPELIQTHKSQESQ--LPEESKSASNKSPLVLE 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 88/233 (38%)
BAP1XP_011532451.1 Peptidase_C12_UCH37_BAP1 5..233 CDD:187738 88/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2778
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.