DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and Uchl5

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_062508.2 Gene:Uchl5 MGIID:1914848 Length:329 Species:Mus musculus

Alignment Length:330 Identity:161/331 (49%)
Similarity:228/331 (69%) Gaps:21/331 (6%)


  Fly    22 ANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL-DDKPAGRVV 85
            |..|||:|||||||||:|.||||.||:||||||::.::|..|:|:|||||||||. .::|||.||
Mouse     5 AGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGSVV 69

  Fly    86 TDR--SDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLANEE 148
            .|.  ..||||:|||.|||||||::.:|||..|:|:.||:||::.:...|..|...:|..|:|.:
Mouse    70 QDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSD 134

  Fly   149 KIRKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQNWLD 213
            .||:|||||||.::|..:..|...|:|.:|||.::|:.|:|:||||:.||||:|...: |.:|:.
Mouse   135 VIRQVHNSFARQQMFEFDTKTPAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACN-QDDWIT 198

  Fly   214 VVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQLSHADR------------- 265
            .|||:||.|:::||.|||.|||||:||||:..||:||   ..|..||:..:.             
Mouse   199 AVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI---AELQRQLAEEEPMDTDQGSTVLSAI 260

  Fly   266 QAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDRSYLCKP 330
            |:|:|..:..:..|.:|.:||:.|||||:|||||||:||||.|.|..||:.:.:|||::.. .|.
Mouse   261 QSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQN-AKK 324

  Fly   331 SKDTR 335
            :::|:
Mouse   325 AQETK 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 117/216 (54%)
Uchl5NP_062508.2 Peptidase_C12 8..223 CDD:187736 117/216 (54%)
Interaction with ADRM1. {ECO:0000250} 313..329 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C171891093
eggNOG 1 0.900 E1_KOG2778
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1802
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003901
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128387
Panther 1 1.100 O PTHR10589
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1589
TreeFam 1 0.960
109.680

Return to query results.
Submit another query.