DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and bap1

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001157309.1 Gene:bap1 ZFINID:ZDB-GENE-050208-492 Length:755 Species:Danio rerio

Alignment Length:330 Identity:110/331 (33%)
Similarity:175/331 (53%) Gaps:64/331 (19%)


  Fly    25 WCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWLDDKPAGR------ 83
            |..:|||||:||.::..||..|.:||||:.:::   :...|::|.||||||::::.:.|      
Zfish     5 WLELESDPGLFTLLVEDFGVKGVQVEEIYDLQS---KCQSPVYGFIFLFKWIEERRSRRKVSTLV 66

  Fly    84 ----VVTDR--SDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGH 142
                |:.|.  :|:|||.|:|||:|||.|||.:|||.  ..::||.||:.::...:..:||.:|:
Zfish    67 DETSVIDDDIVNDMFFAHQLIPNSCATHALLSVLLNC--SGVELGMTLSRMKAFTKGFNPESKGY 129

  Fly   143 RLANEEKIRKVHNSFARPELFVVEESTDFIED----DCYHFVGFMPIKGKLFELDGMHEGPIELA 203
            .:.|..::.|.|||.||||...:.|..:.|..    :.:|||.::|||.:||||||:...||:..
Zfish   130 AIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRLFELDGLKAYPIDHG 194

  Fly   204 DIDQQQNWLDVVRPIIEARMERYSVGE----IHFNLMALVSDRQRCYERKIQMLVNLPSQLSHAD 264
            ...:.:.|.|..|.:|..|:...:.||    |.|||||:|.||:..||.|:.:|        ..:
Zfish   195 PWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYESKLDIL--------KRN 251

  Fly   265 RQAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDRSYLCK 329
            ||..:..|    :..:|||                 ::.:.:|  |:||     |:.:..|   .
Zfish   252 RQIILEGL----QQIREKK-----------------VIRMTQQ--ESGQ-----DRKQQDS---S 285

  Fly   330 PSKDT 334
            .|:||
Zfish   286 SSEDT 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 88/233 (38%)
bap1NP_001157309.1 Peptidase_C12_UCH37_BAP1 5..233 CDD:187738 88/233 (38%)
Nuclear localization signal. {ECO:0000250|UniProtKB:Q92560} 743..748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2778
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.