DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and UCHL5

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006711430.1 Gene:UCHL5 HGNCID:19678 Length:421 Species:Homo sapiens

Alignment Length:342 Identity:159/343 (46%)
Similarity:219/343 (64%) Gaps:47/343 (14%)


  Fly    22 ANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL-DDKPAGRVV 85
            |..|||:|||||||||:|.||||.||:||||||::.:.|..|:|:|||||||||. .::|||.||
Human    72 AGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVV 136

  Fly    86 TD-RSD-IFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLANEE 148
            .| |.| ||||:|||.|||||||::.:|||..|:|:.||:||::.:...|..|...:|..|:|.:
Human   137 QDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSD 201

  Fly   149 KIRKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQNWLD 213
            .||:|||||||.::|..:..|...|:|.:|||.::|:.|:|:||||:.||||:|...: |.:|:.
Human   202 VIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACN-QDDWIS 265

  Fly   214 VVRPIIEARMER---------------------------YSVGEIHFNLMALVSDRQRCYERKIQ 251
            .|||:||.|:::                           ||.|||.|||||:||||:..||:|| 
Human   266 AVRPVIEKRIQKDGFSPCCPGWSQTPELKPSACLDLPKWYSEGEIRFNLMAIVSDRKMIYEQKI- 329

  Fly   252 MLVNLPSQLSHADR-------------QAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVE 303
              ..|..||:..:.             |:|:|..:..:..|.:|.:||:.|||||:|||||||:|
Human   330 --AELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIME 392

  Fly   304 LLKQLGETGQLMAICDK 320
            |||.|.|..||:.:.:|
Human   393 LLKTLAEHQQLIPLVEK 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 119/243 (49%)
UCHL5XP_006711430.1 Peptidase_C12 75..317 CDD:187736 119/243 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C171891236
eggNOG 1 0.900 E1_KOG2778
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1802
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 1 1.000 FOG0003901
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128387
Panther 1 1.100 O PTHR10589
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1589
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.690

Return to query results.
Submit another query.