DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and bap1

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001008206.1 Gene:bap1 XenbaseID:XB-GENE-494978 Length:685 Species:Xenopus tropicalis

Alignment Length:273 Identity:99/274 (36%)
Similarity:153/274 (56%) Gaps:33/274 (12%)


  Fly    25 WCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWLDDKPAGRVVTDRS 89
            |..:|||||:||.::..||..|.:||||:.:::   :...|::|.||||||::::.:.|.|:...
 Frog     5 WLELESDPGLFTLLVEDFGVKGVQVEEIYDLQS---KCPGPVYGFIFLFKWIEERRSRRKVSTLL 66

  Fly    90 D------------IFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGH 142
            |            :|||.|:|||:|||.|||.:|||.  ..:.||.||:.::...:...||.:|:
 Frog    67 DDTSVMEDEVVNNMFFAHQLIPNSCATHALLSVLLNC--SGVHLGPTLSRIKEFTKGFSPESKGY 129

  Fly   143 RLANEEKIRKVHNSFARPELFVVEESTDFIED----DCYHFVGFMPIKGKLFELDGMHEGPIELA 203
            .:.|..::.|.|||.||||...:.|..:.|..    :.:|||.::||||:||||||:...||:..
 Frog   130 AIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRLFELDGLKVYPIDHG 194

  Fly   204 DIDQQQNWLDVVRPIIEARMERYSVGE----IHFNLMALVSDRQRCYERKIQMLVNLPSQLSHAD 264
            ...:.:.|.|..|.:|..|:...:.||    |.|||||:|.||:..||.|:.:|        ..:
 Frog   195 PWAEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRLKYESKLHIL--------KMN 251

  Fly   265 RQAEIANLRSHVR 277
            ||..:..|:..:|
 Frog   252 RQTVLEALQQLIR 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 88/233 (38%)
bap1NP_001008206.1 Peptidase_C12_UCH37_BAP1 5..233 CDD:187738 88/233 (38%)
Nuclear localization signal. {ECO:0000250|UniProtKB:Q92560} 673..678
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2778
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.