DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and uchl5

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_998249.1 Gene:uchl5 ZFINID:ZDB-GENE-040426-2051 Length:329 Species:Danio rerio

Alignment Length:322 Identity:162/323 (50%)
Similarity:225/323 (70%) Gaps:20/323 (6%)


  Fly    19 ATAANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL-DDKPAG 82
            |.:|..|||:|||||||||:|.||||.||:||||||::.:.|.:|:|:|||||||||. .::|||
Zfish     2 AGSAGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEEPAG 66

  Fly    83 RVVTD-RSD-IFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLA 145
            .:|.| |.| ||||:|||.|||||||::.:|||..|.|:.||:|||:.:......|...:|..|:
Zfish    67 SIVQDSRLDQIFFAKQVINNACATQAIISVLLNCTHPDMLLGETLTEFKEFSNSFDAAMKGLALS 131

  Fly   146 NEEKIRKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQN 210
            |.|.||:|||.|||.::|..:..:...|:|.:|||.::|:.|:|:||||:.||||:|. :..|.:
Zfish   132 NSEVIRQVHNGFARQQMFEFDAKSTAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLG-VCNQDD 195

  Fly   211 WLDVVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQLSHADR---------- 265
            |:..|||:||.|:::||.|||.|||||:||||:..||:||   |.|.:||:..:.          
Zfish   196 WISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEKKI---VELQAQLTEEEPMDTDQSGNHL 257

  Fly   266 ---QAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDR 324
               |:|||..:..:..|.:|.:||:.|||||:|||||||:||||.|.|..||:.:.:|||::
Zfish   258 SSIQSEIAKYQLLIEEENQKLKRYKVENIRRKHNYLPFIMELLKTLAEYQQLIPLVEKAKEK 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 117/216 (54%)
uchl5NP_998249.1 Peptidase_C12 8..223 CDD:187736 117/216 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C171888858
eggNOG 1 0.900 E1_KOG2778
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 1 1.000 FOG0003901
OrthoInspector 1 1.000 T597920
orthoMCL 1 0.900 OOG5_128387
Panther 1 1.100 O PTHR10589
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.