DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and Uch-L5

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001261632.1 Gene:Uch-L5 FlyBaseID:FBgn0011327 Length:324 Species:Drosophila melanogaster

Alignment Length:319 Identity:199/320 (62%)
Similarity:255/320 (80%) Gaps:6/320 (2%)


  Fly    22 ANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL-DDKPAGRVV 85
            |.||||||||||||||:|..|||.||:||||||:.:::|::|||||||||||||: :|:|||:||
  Fly     5 AGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQEDEPAGKVV 69

  Fly    86 TDRSDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLANEEKI 150
            .||.:||||:|||.|||||||:|.||:||.||||.||:|||:.:..||..||..:|..|:|..:|
  Fly    70 LDRENIFFAKQVINNACATQAILSLLMNLDHEDIKLGETLTNFKEFCQCFDPYNKGLTLSNASQI 134

  Fly   151 RKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQNWLDVV 215
            |.||||||||.||.::......:||.|||||:|||.|:|:||||:.||||:|.:|..:|||:|||
  Fly   135 RTVHNSFARPTLFELDTKNQKKDDDVYHFVGYMPIGGRLYELDGLREGPIDLGEIKSEQNWIDVV 199

  Fly   216 RPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVN-LPSQL-SHADRQAEIANLRSHVRH 278
            |||||.||:|||.||||||||||:|||||.||::|:.|:| .|:.: :..||||||::||:::.:
  Fly   200 RPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKLLNPAPNAMDTEEDRQAEISSLRTYIEY 264

  Fly   279 EKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDRSY---LCKPSKDT 334
            |.:||:||:.||:||:||||||||||||.|||.||||.|.:|||.|:.   ..:..|||
  Fly   265 EIQKKKRYKVENVRRKHNYLPFIVELLKILGENGQLMPIYEKAKQRALEREQAQRKKDT 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 141/214 (66%)
Uch-L5NP_001261632.1 Peptidase_C12_UCH37_BAP1 8..222 CDD:187738 141/214 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C171881111
eggNOG 1 0.900 E1_KOG2778
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I827
Isobase 1 0.950 0 Normalized mean entropy S1802
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 1 1.000 FOG0003901
orthoMCL 1 0.900 OOG5_128387
Panther 1 1.100 P PTHR10589
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1589
98.870

Return to query results.
Submit another query.