DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and calypso

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_611096.1 Gene:calypso FlyBaseID:FBgn0262166 Length:471 Species:Drosophila melanogaster

Alignment Length:376 Identity:115/377 (31%)
Similarity:179/377 (47%) Gaps:69/377 (18%)


  Fly     3 TENPGAATVEELTTKE-ATAANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPI 66
            :.|...:|....||.. |..|:.|..:|||||:||.::..|||...:|||::.::    :.:|..
  Fly    23 SHNALLSTASGATTMPMAQLADGWLELESDPGLFTLLLKDFGCHDVQVEEVYDLQ----KPIESP 83

  Fly    67 HGLIFLFKWLDDKPAGRVVTDR------------SDIFFARQVIPNACATQALLCLLLNLQHEDI 119
            :|.||||:|::::.|.|.:.:.            |.||||:||:||:|||.|||.:|||....::
  Fly    84 YGFIFLFRWIEERRARRKIVETTAEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNL 148

  Fly   120 DLGQTLTDLRNLCQDLDPECRGHRLANEEKIRKVHNSFARPELFVVEESTDFIEDDC------YH 178
            .||.||:.|:...:.:.||.:|..:.|..::...|||.|.|:.....|.|......|      :|
  Fly   149 QLGDTLSRLKTHTKGMSPENKGLAIGNTPELACAHNSHAMPQARRRLERTGAGVSSCRFTGEAFH 213

  Fly   179 FVGFMPIKGKLFELDGMHEGPIELADIDQQQNWLDVVRPIIEARMERYSVGE--IHFNLMALVSD 241
            ||.|:||.|:||||||:...|:.....:..::|.|..|.::..|: ..:.||  |.|||||:|.|
  Fly   214 FVSFVPINGQLFELDGLKPYPMNHGGWEDSEDWTDKFRRVMAERL-GIATGEQDIRFNLMAVVPD 277

  Fly   242 RQRCYERKIQML------------------------------------VNLPSQLSHADRQAEIA 270
            |:.....|::||                                    :..||..:..|.|:.:.
  Fly   278 RRIAITHKLKMLRTNQAIVSGTLQKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLK 342

  Fly   271 NL-------RSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQL 314
            ||       ..|:..|.:::..::.:..||.|||..||...|..|...|.|
  Fly   343 NLDTEIAINEQHLADENDRRHMFKVDASRRTHNYDKFICTFLSMLAHQGVL 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 84/233 (36%)
calypsoNP_611096.1 Peptidase_C12_UCH37_BAP1 46..274 CDD:187738 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87742023
eggNOG 1 0.900 E1_KOG2778
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10589
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.