DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and Uchl5

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006250022.1 Gene:Uchl5 RGDID:1305414 Length:329 Species:Rattus norvegicus

Alignment Length:330 Identity:161/331 (49%)
Similarity:227/331 (69%) Gaps:21/331 (6%)


  Fly    22 ANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL-DDKPAGRVV 85
            |..|||:|||||||||:|.||||.||:||||||::.:.|..|:|:|||||||||. .::|||.||
  Rat     5 AGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVV 69

  Fly    86 TDR--SDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLANEE 148
            .|.  ..||||:|||.|||||||::.:|||..|:|:.||:||::.:...|..|...:|..|:|.:
  Rat    70 QDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSD 134

  Fly   149 KIRKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQNWLD 213
            .||:|||||||.::|..:..|...|:|.:|||.::|:.|:|:||||:.||||:|...: |.:|:.
  Rat   135 VIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACN-QDDWIT 198

  Fly   214 VVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQLSHADR------------- 265
            .|||:||.|:::||.|||.|||||:||||:..||:||   ..|..||:..:.             
  Rat   199 AVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKI---AELQRQLAEEEPMDTDQGSTVLSAI 260

  Fly   266 QAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDRSYLCKP 330
            |:|:|..:..:..|.:|.:||:.|||||:|||||||:||||.|.|..||:.:.:|||::.. .|.
  Rat   261 QSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQN-AKK 324

  Fly   331 SKDTR 335
            :::|:
  Rat   325 AQETK 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 117/216 (54%)
Uchl5XP_006250022.1 Peptidase_C12 8..223 CDD:187736 117/216 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C171889676
eggNOG 1 0.900 E1_KOG2778
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1882
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 1 1.000 FOG0003901
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10589
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.