DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and Uch

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster

Alignment Length:233 Identity:66/234 (28%)
Similarity:102/234 (44%) Gaps:23/234 (10%)


  Fly    25 WCLIESDPGVFTEMISGFGCTGA-EVEEIWSIKADAFRHL-EPIHGLIFLFKWLDDKPAGRVVT- 86
            |..:||:|.|.|:.|...|.:.| .|.::..::.|....: .|:...|.||...:.....|... 
  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEH 68

  Fly    87 DR---------SDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGH 142
            ||         .|:|:.||...|||.|.||:..:.|.:..|||.| .|.|.......|.||.||.
  Fly    69 DRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKEVDIDRG-VLKDFLEKTASLSPEERGR 132

  Fly   143 RLANEEKIRKVHNSFARPELFVVEESTDFI--EDDCYHFVGFMPIKGKLFELDGMHEGPIELADI 205
            .|..:||....|.:.|:      |..|:..  |...:||:..:..:|.|:||||....||:....
  Fly   133 ALEKDEKFTADHEALAQ------EGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPT 191

  Fly   206 DQQQNWLDVVRPIIEARMERYSVGEIHFNLMALVSDRQ 243
            .::....|..: :.:..|.| ...|:.|.::||.:.:|
  Fly   192 SEETFVKDAAK-VCKEFMAR-DPNEVRFTVLALTAAQQ 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 64/227 (28%)
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 64/227 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87738790
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10589
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.