DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and Bap1

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001100762.1 Gene:Bap1 RGDID:1311938 Length:740 Species:Rattus norvegicus

Alignment Length:286 Identity:97/287 (34%)
Similarity:155/287 (54%) Gaps:46/287 (16%)


  Fly    25 WCLIESDPGVFTEMISGF-------------GCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL 76
            |..:|||||:||.::..|             |..|.:||||:.:::   :...|::|.||||||:
  Rat     5 WLELESDPGLFTLLVEDFGKNPFTPDRRALAGVKGVQVEEIYDLQS---KCQGPVYGFIFLFKWI 66

  Fly    77 DDKPAGRVVTDRSD------------IFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLR 129
            :::.:.|.|:...|            :|||.|:|||:|||.|||.:|||.  .::|||.||:.::
  Rat    67 EERRSRRKVSTLVDDTSVIDDDIVNSMFFAHQLIPNSCATHALLSVLLNC--SNVDLGPTLSRMK 129

  Fly   130 NLCQDLDPECRGHRLANEEKIRKVHNSFARPELFVVEESTDFIED----DCYHFVGFMPIKGKLF 190
            :..:...||.:|:.:.|..::.|.|||.||||...:.|..:.:..    :.:|||.::||.|:||
  Rat   130 DFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLF 194

  Fly   191 ELDGMHEGPIELADIDQQQNWLDVVRPIIEARMERYSVGE----IHFNLMALVSDRQRCYERKIQ 251
            ||||:...||:.....:.:.|.|..|.:|..|:...:.||    |.|||||:|.||:..||.::.
  Rat   195 ELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRVKYEARLH 259

  Fly   252 MLVNLPSQLSHADRQAEIANLRSHVR 277
            :|        ..:||..:..|:..:|
  Rat   260 VL--------KGNRQTVLEALQQLIR 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 87/246 (35%)
Bap1NP_001100762.1 Peptidase_C12_UCH37_BAP1 5..246 CDD:187738 87/246 (35%)
HBM-like motif. {ECO:0000250|UniProtKB:Q92560} 376..379
Interaction with BRCA1. {ECO:0000250} 607..732
Nuclear localization signal. {ECO:0000250|UniProtKB:Q92560} 728..733
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2778
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.