DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and uch2

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_595456.1 Gene:uch2 PomBaseID:SPBC409.06 Length:300 Species:Schizosaccharomyces pombe

Alignment Length:308 Identity:125/309 (40%)
Similarity:173/309 (56%) Gaps:39/309 (13%)


  Fly    24 NWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWLD--DKPAGRVVT 86
            :|..||||.||||::|...|....||:|::|:..|:.|....|:|:||||||..  |||.|.:..
pombe     2 SWTTIESDAGVFTDLIENLGVKDVEVDELYSLDVDSLRQFPDIYGIIFLFKWNSKVDKPDGTMDY 66

  Fly    87 DRSD-IFFARQVIPNACATQALLCLLLNLQHED-IDLGQTLTDLRNLCQDLDPECRGHRLANEEK 149
            |..| ||||:|||.|||||||||.:|||  |.| ||||.||::.::..:.|.||.:|..|.|.|.
pombe    67 DSMDNIFFAKQVINNACATQALLSVLLN--HSDEIDLGTTLSEFKDFSKTLPPELKGEALGNSEH 129

  Fly   150 IRKVHNSFARPELFVVEE---STDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQNW 211
            ||..||||||.:.|:.||   :||  ||:.|||:.:..|....:||||:...||......::: :
pombe   130 IRCCHNSFARSDPFISEEVRAATD--EDEVYHFIAYTNINNVFYELDGLQAAPINHGSCTKEE-F 191

  Fly   212 LDVVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQLSHADRQAEIANLRSHV 276
            .:....:|:||:..|...||.||||.:      |.::|..:|..  ..|:..::.|.||      
pombe   192 AEKAVSVIQARIANYDPAEIRFNLMVI------CKDKKASLLTR--EDLTDEEKAASIA------ 242

  Fly   277 RHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDR 324
             .|.||:.|:::||..||||::...|||.|.|            .|||
pombe   243 -VEDEKRLRWKRENQLRRHNFVGLFVELSKLL------------VKDR 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 100/220 (45%)
uch2NP_595456.1 Peptidase_C12_UCH37_BAP1 3..218 CDD:187738 100/220 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H137906
Inparanoid 1 1.050 201 1.000 Inparanoid score I978
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003901
OrthoInspector 1 1.000 T631772
orthoMCL 1 0.900 OOG5_128387
Panther 1 1.100 O PTHR10589
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1589
TreeFam 1 0.960
1010.050

Return to query results.
Submit another query.