DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch-L5R and uch2

DIOPT Version :9

Sequence 1:NP_572781.1 Gene:Uch-L5R / 32173 FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_595456.1 Gene:uch2 / 2540956 PomBaseID:SPBC409.06 Length:300 Species:Schizosaccharomyces pombe


Alignment Length:308 Identity:125/308 - (40%)
Similarity:173/308 - (56%) Gaps:39/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWLD--DKPAGRVVT 86
            :|..||||.||||::|...|....||:|::|:..|:.|....|:|:||||||..  |||.|.:..
pombe     2 SWTTIESDAGVFTDLIENLGVKDVEVDELYSLDVDSLRQFPDIYGIIFLFKWNSKVDKPDGTMDY 66

  Fly    87 DRSD-IFFARQVIPNACATQALLCLLLNLQHED-IDLGQTLTDLRNLCQDLDPECRGHRLANEEK 149
            |..| ||||:|||.|||||||||.:|||  |.| ||||.||::.::..:.|.||.:|..|.|.|.
pombe    67 DSMDNIFFAKQVINNACATQALLSVLLN--HSDEIDLGTTLSEFKDFSKTLPPELKGEALGNSEH 129

  Fly   150 IRKVHNSFARPELFVVEE---STDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQNW 211
            ||..||||||.:.|:.||   :||  ||:.|||:.:..|....:||||:...||......::: :
pombe   130 IRCCHNSFARSDPFISEEVRAATD--EDEVYHFIAYTNINNVFYELDGLQAAPINHGSCTKEE-F 191

  Fly   212 LDVVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQLSHADRQAEIANLRSHV 276
            .:....:|:||:..|...||.||||.:      |.::|..:|..  ..|:..::.|.||      
pombe   192 AEKAVSVIQARIANYDPAEIRFNLMVI------CKDKKASLLTR--EDLTDEEKAASIA------ 242

  Fly   277 RHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDR 324
             .|.||:.|:::||..||||::...|||.|.|            .|||
pombe   243 -VEDEKRLRWKRENQLRRHNFVGLFVELSKLL------------VKDR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 100/219 (46%)
uch2NP_595456.1 Peptidase_C12_UCH37_BAP1 3..218 CDD:187738 100/219 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 167 1.000 Domainoid score I927
eggNOG 1 0.900 - - E1_KOG2778
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H137906
Inparanoid 1 1.050 201 1.000 Inparanoid score I992
OMA 1 1.010 - - QHG53985
OrthoFinder 1 1.000 - - FOG0001783
OrthoInspector 1 1.000 - - otm46989
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10589
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1589
SonicParanoid 1 1.000 - - X1137
TreeFam 1 0.960 - -
1312.960

Return to query results.
Submit another query.