DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and ubh-4

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_495684.2 Gene:ubh-4 WormBaseID:WBGene00006724 Length:321 Species:Caenorhabditis elegans

Alignment Length:313 Identity:146/314 (46%)
Similarity:208/314 (66%) Gaps:11/314 (4%)


  Fly    20 TAANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWLDDKPAGRV 84
            |.|.:||||||||||||||:.|||..|.:|||::|:..|. ....|.:||||||||........:
 Worm     2 TDAGSWCLIESDPGVFTEMLRGFGVDGLQVEELYSLDDDK-AMTRPTYGLIFLFKWRQGDETTGI 65

  Fly    85 VTDRSDIFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLANEEK 149
            .:|:.:||||.|.|.||||||||:.||:|::..|:.||..|...:....||||..|||.|:|.|:
 Worm    66 PSDKQNIFFAHQTIQNACATQALINLLMNVEDTDVKLGNILNQYKEFAIDLDPNTRGHCLSNSEE 130

  Fly   150 IRKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQNWLDV 214
            ||.|||||:|..||.::......||: ||||.::||..|::||||:.|.|:|:|:..::|:|::.
 Worm   131 IRTVHNSFSRQTLFELDIKGGESEDN-YHFVTYVPIGNKVYELDGLRELPLEVAEFQKEQDWIEA 194

  Fly   215 VRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQ-MLVNLPSQLSHADRQAEIANLRSHVRH 278
            ::|:|:.||::||.|||.|||||||.:|    ::|:| |:.||.....:.:.:.:||:|...:..
 Worm   195 IKPVIQQRMQKYSEGEITFNLMALVPNR----KQKLQEMMENLIQANENNELEEQIADLNKAIAD 255

  Fly   279 EKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDK----AKDRSYL 327
            |..|...|||||.||||||.||::||:|.|.:.|:|:.:.|.    ||::|.|
 Worm   256 EDYKMEMYRKENNRRRHNYTPFVIELMKILAKEGKLVGLVDNAYQAAKEKSKL 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 107/213 (50%)
ubh-4NP_495684.2 Peptidase_C12_UCH37_BAP1 7..218 CDD:187738 107/213 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C171881136
eggNOG 1 0.900 E1_KOG2778
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I1457
Isobase 1 0.950 0 Normalized mean entropy S1802
OMA 1 1.010
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 1 1.000 FOG0003901
OrthoInspector 1 1.000 T375117
orthoMCL 1 0.900 OOG5_128387
Panther 1 1.100 O PTHR10589
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1589
TreeFam 1 0.960
1413.750

Return to query results.
Submit another query.