DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uch-L5R and uchl5

Sequence 1:NP_572781.1 Gene:Uch-L5R FlyBaseID:FBgn0030370 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_002939132.1 Gene:uchl5 XenbaseID:XB-GENE-968743 Length:329 Species:Xenopus tropicalis

Alignment Length:322 Identity:157/323 (49%)
Similarity:221/323 (68%) Gaps:20/323 (6%)


  Fly    19 ATAANNWCLIESDPGVFTEMISGFGCTGAEVEEIWSIKADAFRHLEPIHGLIFLFKWL-DDKPAG 82
            |.:|..|||:|||||||||:|.||||.|.:||||||::.:.|..|:|:.||||||||. .::|||
 Frog     2 AGSAGEWCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFEDLQPVQGLIFLFKWQPGEEPAG 66

  Fly    83 RVVTD-RSD-IFFARQVIPNACATQALLCLLLNLQHEDIDLGQTLTDLRNLCQDLDPECRGHRLA 145
            .||.| |.| ||||:|||.|||||||::.:|||..|.|:.||:||::.:...|..|...:|..|:
 Frog    67 SVVQDSRLDTIFFAKQVINNACATQAIISILLNTTHTDVHLGETLSEFKEFTQSFDAAMKGLALS 131

  Fly   146 NEEKIRKVHNSFARPELFVVEESTDFIEDDCYHFVGFMPIKGKLFELDGMHEGPIELADIDQQQN 210
            |.|.||:|||||||.::|..:..:...:||.:|||.::|:.|:|:||||:.:|||:|... ::..
 Frog   132 NSEVIRQVHNSFARQQMFEFDAKSTTKDDDAFHFVSYVPVNGRLYELDGLRDGPIDLGPC-KEDE 195

  Fly   211 WLDVVRPIIEARMERYSVGEIHFNLMALVSDRQRCYERKIQMLVNLPSQLSH------------- 262
            |:...||:||.||::|..|||.|||||:||||::.||:||   .:|..:|:.             
 Frog   196 WISAARPVIEKRMQKYCEGEIRFNLMAIVSDRKKIYEQKI---TDLQRRLAEEEPMDTDQGSTLM 257

  Fly   263 ADRQAEIANLRSHVRHEKEKKRRYRKENIRRRHNYLPFIVELLKQLGETGQLMAICDKAKDR 324
            :..|:|||..:..:..|.:|.:||:.|||||:|||||||:||||.|.|..||:.:.:|||::
 Frog   258 SSMQSEIAKYQLLIEEENQKIKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEK 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uch-L5RNP_572781.1 Peptidase_C12_UCH37_BAP1 25..238 CDD:187738 114/216 (53%)
uchl5XP_002939132.1 Peptidase_C12_UCH37_BAP1 8..223 CDD:187738 114/216 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C171887657
eggNOG 1 0.900 E1_KOG2778
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1825
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363547at2759
OrthoFinder 1 1.000 FOG0003901
OrthoInspector 1 1.000 T602066
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1589
TreeFam 1 0.960
109.790

Return to query results.
Submit another query.