DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp318a1 and Cyp4f18

Sequence 1:NP_727590.1 Gene:Cyp318a1 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_077764.2 Gene:Cyp4f18 MGIID:1919304 Length:524 Species:Mus musculus

Alignment Length:457 Identity:109/458 (24%)
Similarity:180/458 (39%) Gaps:104/458 (23%)


  Fly    81 LLYIDDPAGMECVLNAPECLDKTFLQDGFFVR-------RGLLHARGQKWKLRRKQLNPAFSHNI 138
            ::.|..||.::.|:.||..:..   :|..|.|       .|||.:.|.||...|:.|.|||..||
Mouse    98 VIRIFHPAFIKPVVLAPALVAP---KDTVFYRFLKPWLGDGLLMSTGDKWSRHRRMLTPAFHFNI 159

  Fly   139 VASFFDVFNSVGNQMVEQFQTQTNLHGQA-------VKFTAAEDLLS-----------------R 179
            :..:..|||...|.|..::|...: .|.|       :.....:.|..                 .
Mouse   160 LKPYVKVFNDSTNIMHAKWQRLAS-KGSAYLNMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYIT 223

  Fly   180 AVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESKKC 244
            |:||:|.|                :|..::|||           |.:.|.:.|....:  ..:|.
Mouse   224 AILELSTL----------------VARRHQRLL-----------LHVDLFYYLTHDGM--RFRKA 259

  Fly   245 AKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANGE-----MTLEE 304
            .:|:.||...::|.:.|.  |.|     :.|.|......:...::.|..|..:.:     ::.|:
Mouse   260 CRLVHDFTDAVIRERRRT--LLD-----QGGVDVLKAKAKAKTLDFIDVLLLSKDEHGKALSDED 317

  Fly   305 IMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPD--VGQVGLEQLQQLRYL 367
            |..||.:.:....:|.::.:...|..||.:. :.|.|...|:|.|:.|  ..::..:.|.||.:|
Mouse   318 IRAEADTFMFGGHDTTASGLSWILYNLARHP-EYQERCRQEVRELLRDREPEEIEWDDLAQLPFL 381

  Fly   368 DAFVSESLRLLATVPMNLRHVSRDFRLA-GRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFD 431
            ...:.|||||...|....|..::|..|. ||    ::|:..|..:..|....:...| .:...:|
Mouse   382 TMCIKESLRLHPPVTAISRCCTQDIVLPDGR----VIPKGVISRISIFGTHHNPAVW-PDPEVYD 441

  Fly   432 PQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLIT 496
            |.||           ..|:..|        |...:|:|||.|.|:|||:.:.:..|||.|...:.
Mouse   442 PFRF-----------DADNVKG--------RSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLL 487

  Fly   497 NF 498
            .|
Mouse   488 RF 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 109/458 (24%)
Cyp4f18NP_077764.2 p450 52..514 CDD:278495 109/458 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.