DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp318a1 and cyp19a1a

Sequence 1:NP_727590.1 Gene:Cyp318a1 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_571229.3 Gene:cyp19a1a ZFINID:ZDB-GENE-990415-43 Length:517 Species:Danio rerio

Alignment Length:536 Identity:115/537 (21%)
Similarity:199/537 (37%) Gaps:143/537 (27%)


  Fly     9 ACGA-------LLAVLLAWQQRK---------------------CWRLIWQ--------LNGWRG 37
            ||||       ||.:|||.:..:                     | |.||.        .|...|
Zfish    39 ACGATATILLLLLCLLLAIRHHRPHKSHIPGPSFFFGLGPVVSYC-RFIWSGIGTASNYYNSKYG 102

  Fly    38 VIQQPVLWLLLCINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLY---IDDPAGMECVLNAPEC 99
            .|.:  :|    ||.....||.:.|          ||....|..||   .....|::|:      
Zfish   103 DIVR--VW----INGEETLILSRSS----------AVYHVLRKSLYTSRFGSKLGLQCI------ 145

  Fly   100 LDKTFLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLH 164
                    |...:..:.::....||..|.....|.:...:....::..:..|..::.....|:..
Zfish   146 --------GMHEQGIIFNSNVALWKKVRAFYAKALTGPGLQRTMEICTTSTNSHLDDLSQLTDAQ 202

  Fly   165 GQAVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLL 229
            ||    ....:||...|::||....:|.|.|  :.|.....|.|   .:.....::||.:..|| 
Zfish   203 GQ----LDILNLLRCIVVDVSNRLFLGVPLN--EHDLLQKIHKY---FDTWQTVLIKPDVYFRL- 257

  Fly   230 HRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQL 294
                 ..|:::.|:.|:.|:|.:..::..|    :::.|...:....|         |..::...
Zfish   258 -----DWLHKKHKRDAQELQDAITALIEQK----KVQLAHAEKLDHLD---------FTAELIFA 304

  Fly   295 AANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLAEIRALVPDVGQ-VGL 358
            .::||::.|.:......||:.:.:|:|.|:...||.|..|. |.:.::|.|:.:::  .|| :..
Zfish   305 QSHGELSAENVRQCVLEMVIAAPDTLSISLFFMLLLLKQNP-DVELKILQEMDSVL--AGQSLQH 366

  Fly   359 EQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIVVLDTFNMQRDERWW 423
            ..|.:|:.|::|::||||....|...:|....|..:.|..    |.:.:.::|:...|.|.|.:.
Zfish   367 SHLSKLQILESFINESLRFHPVVDFTMRRALDDDVIEGYN----VKKGTNIILNVGRMHRSEFFS 427

  Fly   424 GANARQFD------PQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGLRSCIGRRY 482
            ..|....|      |.||                               |.||.:|.|||:|:..
Zfish   428 KPNQFSLDNFHKNVPSRF-------------------------------FQPFGSGPRSCVGKHI 461

  Fly   483 GLFIMKVFLVKLITNF 498
            .:.:||..||.|::.|
Zfish   462 AMVMMKSILVALLSRF 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 99/468 (21%)
cyp19a1aNP_571229.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.