DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB7 and zen2

DIOPT Version :9

Sequence 1:NP_004493.3 Gene:HOXB7 / 3217 HGNCID:5118 Length:217 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:90 Identity:44/90 - (48%)
Similarity:55/90 - (61%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   116 SDL----AAESNFRIYPWMRSSGTDR-KRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLC 175
            |||    ..|.|....|...:..::: ||.|..::..|.:|||:|||.|:||.|.|||||:..|.
  Fly    17 SDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLA 81

Human   176 LTERQIKIWFQNRRMKWKKENKTAG 200
            |||||:||||||||||.||.....|
  Fly    82 LTERQVKIWFQNRRMKLKKSTNRKG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB7NP_004493.3 Antp-type hexapeptide 126..131 1/4 (25%)
Homeobox 141..193 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..217 2/7 (29%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.