DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB7 and zen2

DIOPT Version :10

Sequence 1:NP_004493.3 Gene:HOXB7 / 3217 HGNCID:5118 Length:217 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:90 Identity:44/90 - (48%)
Similarity:55/90 - (61%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   116 SDL----AAESNFRIYPWMRSSGTDR-KRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLC 175
            |||    ..|.|....|...:..::: ||.|..::..|.:|||:|||.|:||.|.|||||:..|.
  Fly    17 SDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLA 81

Human   176 LTERQIKIWFQNRRMKWKKENKTAG 200
            |||||:||||||||||.||.....|
  Fly    82 LTERQVKIWFQNRRMKLKKSTNRKG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB7NP_004493.3 Antp-type hexapeptide 126..131 1/4 (25%)
Homeodomain 138..194 CDD:459649 35/55 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..217 2/7 (29%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 35/55 (64%)

Return to query results.
Submit another query.