DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tango4 and plrg1

Sequence 1:NP_572778.1 Gene:Tango4 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001032331.1 Gene:plrg1 XenbaseID:XB-GENE-964754 Length:517 Species:Xenopus tropicalis

Alignment Length:516 Identity:309/517 (60%)
Similarity:368/517 (71%) Gaps:43/517 (8%)


  Fly     3 MEDVQKHSVHTLIFRSLKRTHDLFVSNQGNLPEIDERLEKLRRSIKAKDGYGLVLDKVAKIGEAR 67
            :|||||||||||||||||||||:||::......|||...||:.|:|.:..|..|| .:..:.|.|
 Frog     9 VEDVQKHSVHTLIFRSLKRTHDMFVADNAKPIPIDEESHKLKMSVKLRTEYSSVL-HMPVLKENR 72

  Fly    68 KA------------SGAQT-------------PGDKTLAITDGSATDAASGAGSLVKYNAGARP- 106
            :.            .|.::             ||....|.|......:.|.|.||    |.|.| 
 Frog    73 EKGHHEAYEHYTAHQGTESEYMLTGTHPYPSGPGVALTADTQIQRMPSESAAQSL----ALALPP 133

  Fly   107 ------AEKTAPLVTGTHTSLVRASLAN----SNADMSANGAIASHLQLIPKKAPSIPKPKWHAP 161
                  |::||..|...:........:.    |.|.|.:.|  ..:..|:.||||::|||:||.|
 Frog   134 SQSRLEAQRTAASVGDIYRHAGHPERSQPPGLSMASMESGG--TKNSALVAKKAPTMPKPQWHPP 196

  Fly   162 WKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKH 226
            |||.||||||||||||:||||||:||.||:.||.||||||||||||||||||:||||||.||.:.
 Frog   197 WKLYRVISGHLGWVRCLAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRS 261

  Fly   227 PYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANV 291
            |||||||||:||||||||||||||||||||||||.|.||||||||.|..|||||||||:||||.|
 Frog   262 PYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKAGV 326

  Fly   292 HTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHPSLYMFA 356
            |||.||||.||:|..||..|||||||||:|:||||:..||:..||||||||||::||||..|.||
 Frog   327 HTLVGHTNAVATVRCQAAEPQIITGSHDTTIRLWDMVGGKTRVTLTNHKKSVRAVVLHPRQYTFA 391

  Fly   357 SASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVSGGDNGTMFFWDWRTGYNFQRFQAP 421
            |.||||||||:.|:|.|:||:|||.:|:|.:|.||:||||||.|||||..|||||||||||..|.
 Frog   392 SGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTMHLWDWRTGYNFQRIHAA 456

  Fly   422 VQPGSMDSEAGIFAMCFDQSGSRLITAEADKTIKVYKEDDEASEESHPINWRPDLLKRRKF 482
            |||||:|||:||||..||||.|||||||||||||||:||:.|:||:||::|:|:::||::|
 Frog   457 VQPGSLDSESGIFACTFDQSESRLITAEADKTIKVYREDETATEETHPVSWKPEIIKRKRF 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 232/297 (78%)
WD40 164..458 CDD:238121 229/294 (78%)
WD40 repeat 177..212 CDD:293791 29/35 (83%)
WD40 repeat 218..254 CDD:293791 31/36 (86%)
WD40 repeat 259..295 CDD:293791 29/36 (81%)
WD40 repeat 302..337 CDD:293791 22/35 (63%)
WD40 repeat 343..378 CDD:293791 23/35 (66%)
WD40 repeat 386..426 CDD:293791 30/40 (75%)
WD40 repeat 433..457 CDD:293791 21/24 (88%)
plrg1NP_001032331.1 WD40 <196..492 CDD:225201 231/296 (78%)
WD40 199..493 CDD:238121 229/294 (78%)
WD40 repeat 212..247 CDD:293791 29/35 (83%)
WD40 repeat 253..289 CDD:293791 31/36 (86%)
WD40 repeat 294..330 CDD:293791 29/36 (81%)
WD40 repeat 337..372 CDD:293791 22/35 (63%)
WD40 repeat 378..413 CDD:293791 23/35 (66%)
WD40 repeat 419..458 CDD:293791 28/39 (72%)
WD40 repeat 465..492 CDD:293791 23/27 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C211927687
eggNOG 1 0.900 E1_KOG0285
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2004
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1157847at2759
OrthoFinder 1 1.000 FOG0003511
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.