DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tango4 and prp5

Sequence 1:NP_572778.1 Gene:Tango4 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_595604.1 Gene:prp5 PomBaseID:SPBP22H7.07 Length:473 Species:Schizosaccharomyces pombe

Alignment Length:475 Identity:248/476 (52%)
Similarity:327/476 (69%) Gaps:20/476 (4%)


  Fly    11 VHTLIFRSLKRTHDLFVSNQGNLPEIDERL-EKLRRSIKAKDGYGLVLDKVAKIGEARKASGAQ- 73
            |.:|...||:.:..||.:..|::...|:.: :.|:|:.|....||.||.  ..:|:.:.....: 
pombe    13 VLSLTTNSLRTSKTLFGAEFGSVTSFDDTVAQNLKRTYKEHLEYGSVLG--GTVGKRKNRHYEED 75

  Fly    74 TPGDKTLAITDGSATDAASGAGSLVKYNAGARPAEKTAPLVTGTHTSLVRASLANSNADMSANGA 138
            |.|...|.:...|...::.   .:.|:   :.|.:|.|..|:       ..||........|...
pombe    76 TIGSNALTVRADSENPSSQ---VITKF---SDPNKKIAGQVS-------MQSLEKIKGVPEAAHR 127

  Fly   139 IA--SHLQLIPKKAPSIPKPKWHAPWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDL 201
            ||  |...|:.:......:|:|||||.|.||||||||||||:.|||||:||.||||||.||||||
pombe   128 IAGESQASLVKRTLAEQIRPEWHAPWTLMRVISGHLGWVRCVDVEPGNQWFCTGAGDRTIKIWDL 192

  Fly   202 ASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHP 266
            |||.|||:||||::||||:|||.:||||||||||:.|||||||.||||||||||||.||:|.|||
pombe   193 ASGVLKLTLTGHIATVRGLAVSPRHPYLFSCGEDKMVKCWDLETNKVIRHYHGHLSGVYALKLHP 257

  Fly   267 TIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGK 331
            |:|||.|:|||:.||:|||||:.|||.|:||.:||||:..|..:||::|||.|||:|||||||||
pombe   258 TLDVLVTAGRDAVARVWDMRTRQNVHVLSGHKSTVASLAVQEFDPQVVTGSMDSTIRLWDLAAGK 322

  Fly   332 SVCTLTNHKKSVRSIVLHPSLYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLV 396
            ::.|||:|||:||::.|||..:.|||.|.||||.|:.|||.|:.|..||.:|||.::.||:.|:.
pombe   323 TLTTLTHHKKTVRALSLHPDEFTFASGSSDNIKHWKFPEGAFMGNFEGHNAIVNTLSINSDNVMF 387

  Fly   397 SGGDNGTMFFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGSRLITAEADKTIKVYKEDD 461
            ||.|||:|.||||::|:.:|..|:.|||||:||||||||..||::|.||||.||||::|:||:.|
pombe   388 SGADNGSMCFWDWKSGHKYQELQSVVQPGSLDSEAGIFASSFDKTGLRLITCEADKSVKIYKQVD 452

  Fly   462 EASEESHP-INWRPDLLKRR 480
            .|:.|:|| :.|.|..|:||
pombe   453 NATPETHPNLPWTPSNLRRR 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 201/297 (68%)
WD40 164..458 CDD:238121 199/294 (68%)
WD40 repeat 177..212 CDD:293791 28/35 (80%)
WD40 repeat 218..254 CDD:293791 30/36 (83%)
WD40 repeat 259..295 CDD:293791 25/36 (69%)
WD40 repeat 302..337 CDD:293791 22/35 (63%)
WD40 repeat 343..378 CDD:293791 19/35 (54%)
WD40 repeat 386..426 CDD:293791 20/40 (50%)
WD40 repeat 433..457 CDD:293791 15/24 (63%)
prp5NP_595604.1 WD40 <143..402 CDD:225201 176/259 (68%)
WD40 155..449 CDD:238121 199/294 (68%)
WD40 repeat 168..203 CDD:293791 28/35 (80%)
WD40 repeat 209..245 CDD:293791 30/36 (83%)
WD40 repeat 250..286 CDD:293791 25/36 (69%)
WD40 repeat 293..328 CDD:293791 22/35 (63%)
WD40 repeat 334..369 CDD:293791 19/35 (54%)
WD40 repeat 375..414 CDD:293791 19/39 (49%)
WD40 repeat 424..448 CDD:293791 15/24 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2004
Inparanoid 1 1.050 489 1.000 Inparanoid score I253
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003511
OrthoInspector 1 1.000 T1125809
orthoMCL 1 0.900 OOG5_128222
Panther 1 1.100 LDO PTHR19923
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R995
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.