DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tango4 and plrg1

Sequence 1:NP_572778.1 Gene:Tango4 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_998605.1 Gene:plrg1 ZFINID:ZDB-GENE-040426-2787 Length:511 Species:Danio rerio

Alignment Length:533 Identity:309/534 (58%)
Similarity:366/534 (69%) Gaps:78/534 (15%)


  Fly     4 EDVQKHSVHTLIFRSLKRTHDLFVSNQGNLPEIDERLEKLRRSIKAKDGYGLVLD-KVAKIGEAR 67
            |||||||||||:|||||||||:||::.......||:..|::.:.|.:..|..||. .|.|.|..:
Zfish     3 EDVQKHSVHTLVFRSLKRTHDMFVADHAKPIAQDEQSFKVKMAAKMRAEYKAVLHMPVLKEGREK 67

  Fly    68 KASGAQTPGDKTLAITDGSATDAASGAGSLVKYNAGARPAEKTAP--LVTGTH------------ 118
            .:.....|                        |...|.|...|.|  ||||||            
Zfish    68 GSLHTSDP------------------------YGQSAYPLPDTTPEYLVTGTHPYPSAPGVVLTA 108

  Fly   119 ---------------------TSLVRASLANSNADMS-----ANGAIASH-------------LQ 144
                                 .|..|...:.:.|.::     |.||..||             ..
Zfish   109 DTQMLKMPSEMGVHSMALALPPSQARQEASRTAASVAEIHRHAGGAERSHPPQHALSLMEGGTRT 173

  Fly   145 LIPKKAPSIPKPKWHAPWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLS 209
            |:|:|||::|||:||.||||.|||||||||||.|||||||:||.||:.||.||||||||||||||
Zfish   174 LVPRKAPTMPKPQWHPPWKLYRVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWDLASGKLKLS 238

  Fly   210 LTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATS 274
            ||||:|||||||||.:.|||||||||:||||||||||||||||||||||||.|.||||||||.|.
Zfish   239 LTGHISTVRGVAVSNRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDLDLHPTIDVLVTC 303

  Fly   275 GRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNH 339
            .||:|||:||:|||||||||:|||||||:|..|:..||::|||||:|:|||||.|||:..|||||
Zfish   304 SRDATARVWDIRTKANVHTLSGHTNTVATVKCQSAEPQVVTGSHDTTIRLWDLVAGKTRATLTNH 368

  Fly   340 KKSVRSIVLHPSLYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVSGGDNGTM 404
            |||||::||||..|.|||.||||||||:.|:|.|:||:|||.:|:|.:|.||:||||||.||||:
Zfish   369 KKSVRALVLHPRQYTFASGSPDNIKQWKFPDGNFIQNLSGHNAIINTLAVNSDGVLVSGADNGTI 433

  Fly   405 FFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGSRLITAEADKTIKVYKEDDEASEESHP 469
            ..|||||||||||..|.|||||:|||:|||:..||||.|||||||||||||||||||.|:|||||
Zfish   434 HMWDWRTGYNFQRIHAAVQPGSLDSESGIFSCVFDQSESRLITAEADKTIKVYKEDDTATEESHP 498

  Fly   470 INWRPDLLKRRKF 482
            :||:|::|||::|
Zfish   499 VNWKPEILKRKRF 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 230/297 (77%)
WD40 164..458 CDD:238121 227/294 (77%)
WD40 repeat 177..212 CDD:293791 29/35 (83%)
WD40 repeat 218..254 CDD:293791 32/36 (89%)
WD40 repeat 259..295 CDD:293791 28/36 (78%)
WD40 repeat 302..337 CDD:293791 21/35 (60%)
WD40 repeat 343..378 CDD:293791 23/35 (66%)
WD40 repeat 386..426 CDD:293791 29/40 (73%)
WD40 repeat 433..457 CDD:293791 20/24 (83%)
plrg1NP_998605.1 WD40 <190..504 CDD:225201 243/314 (77%)
WD40 193..487 CDD:238121 227/294 (77%)
WD40 repeat 206..241 CDD:293791 29/35 (83%)
WD40 repeat 247..283 CDD:293791 32/36 (89%)
WD40 repeat 288..324 CDD:293791 28/36 (78%)
WD40 repeat 331..366 CDD:293791 21/35 (60%)
WD40 repeat 372..407 CDD:293791 23/35 (66%)
WD40 repeat 413..451 CDD:293791 26/38 (68%)
WD40 repeat 462..486 CDD:293791 20/24 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C211923223
eggNOG 1 0.900 E1_KOG0285
Hieranoid 1 1.000
Homologene 1 1.000 H2004
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1157847at2759
OrthoFinder 1 1.000 FOG0003511
OrthoInspector 1 1.000 T1054421
orthoMCL 1 0.900 OOG5_128222
Panther 1 1.100 LDO PTHR19923
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R995
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.