DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1492 and si:ch73-236c18.3

DIOPT Version :8

Sequence 1:NP_001303553.1 Gene:CG1492 / 32164 FlyBaseID:FBgn0030361 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_017212376.1 Gene:si:ch73-236c18.3 / 794105 ZFINID:ZDB-GENE-121214-50 Length:548 Species:Danio rerio

Alignment Length:572 Identity:187/573 (33%)
Similarity:296/573 (52%) Gaps:75/573 (13%)


  Fly    57 FSRAAICSDSDVCSQLAKKVLENGGSAVDGALAALICNGLIGMQSMGIGGGMVMNVYVAKENKSY 121
            :.:||:.:|::.||.:.:.:|:.||||||.|:|||:|..:|..||:|||||:|..:|.|...|..
Zfish    16 YGKAAVATDAETCSDIGRDILQRGGSAVDAAIAALLCVSVINPQSIGIGGGVVFTIYNASTGKVE 80

  Fly   122 SILAREMAPLALRADNFSSFRDEQDFKRSGWSIAVPAELAGYAVAHQRFGRLKWKDLVLPTLELC 186
            :|.|||.||::..||.|.   :..:..:.|..||||.||.||.:||.|.|||:||:|..|:::|.
Zfish    81 TINARETAPMSATADMFD---NNNNNTKPGLLIAVPGELRGYKLAHDRHGRLEWKELFKPSIKLA 142

  Fly   187 RRGYRLYKHQYDALILNQDMIRADSGLRRMFIDPDTG--------RFWPLGHLIRPAAQLCNTYD 243
            |:|:::.|...||:...:|..:.::.|..:|.|.|..        ||          :||..||.
Zfish   143 RKGFKIGKALADAIKEEEDKFQKNTTLCEVFCDADYNLPKINDYIRF----------SQLAATYR 197

  Fly   244 RLANEGPLSFYRGSIADDLLADLKDAGSAITKEDLNQAHAKLS-SAIVMPLDEYDLHLTPPPGSG 307
            :::.|||.:||.||:...::.|::.||..||::||......|: |||...:.:|..|....|..|
Zfish   198 KISEEGPDAFYNGSLTQSIVDDIRAAGGNITRKDLTDYEPVLTESAINFNVGKYIFHAPGAPFGG 262

  Fly   308 HVLGFIMNIL--------KEFRAEFSRAGTMSPRQI--HLMVEAMKFGFVKRWQLDESASE---- 358
            .||..||.||        ..|........|...:.:  |.::|.:....|::.:|.:...:    
Zfish   263 PVLTLIMKILLGNGTKGFSGFNLSKKSVSTTKNKTLTYHRIIETLCIADVEKTKLGDPLKQPIVN 327

  Fly   359 ELLSNLTS--------HELAKSVARQINHTHTFNRPEFYGASPGIQIRDEHGTAHTSVL--HGND 413
            |::.|:.|        .|:..|:|...|.::..::          .:.|:.||:|.||:  .|| 
Zfish   328 EVVKNMISDSFADHNRSEIDDSIATACNKSNNVSK----------SVPDDSGTSHVSVIDAEGN- 381

  Fly   414 AVSVTSSINFYFGSGRTGRRTGVIFNNAMSDFSIEQLKNYFDLPFVPGTNGVAPAARPMSSMCPV 478
            ||:||||||.|||||.....||:|||:.|.||:..:            .|.:....||:|||||.
Zfish   382 AVAVTSSINNYFGSGVMSECTGIIFNDQMKDFTDNE------------HNRIEKGKRPLSSMCPT 434

  Fly   479 IVTERATGN---VRLVVGAAGGTKIISALSPLLVRILWQEASIKAAIDASRIHHQMLPNVLLYEY 540
            |:.:....|   |.:||||.|||.|.:|::.:::..|:.:..:|.|::|||:  |:..||...|.
Zfish   435 IILDEEKENSEKVTMVVGAEGGTNITTAVAQVILNYLYFDYDLKDAVNASRV--QIKNNVTNVEP 497

  Fly   541 GLRQSYVDSLAERGHRCERYENRGSVICGIAQANDTIWVNSDFRKPGGVSGF 592
            |..:..:..|.::.|.... :...||:..|.:..|.:...||.||.|..:|:
Zfish   498 GFDKDVIKGLEQKYHVIGN-KTEVSVVQVIDREKDKVCAVSDHRKYGNPAGY 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1492NP_001303553.1 G_glu_transpept 76..587 CDD:279371 180/547 (33%)
si:ch73-236c18.3XP_017212376.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D176986at33208
OrthoFinder 1 1.000 FOG0000255
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11686
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.