DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1492 and Ggt5

DIOPT Version :8

Sequence 1:NP_001303553.1 Gene:CG1492 / 32164 FlyBaseID:FBgn0030361 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_062108.2 Gene:Ggt5 / 29566 RGDID:2684 Length:572 Species:Rattus norvegicus

Alignment Length:630 Identity:199/631 (32%)
Similarity:295/631 (47%) Gaps:109/631 (17%)


  Fly     3 IRIGLNSLISVVIVILVAVYIYRYPDGNAGKKKASRRPPNPEDPLPPSNSPLHRFSRAAICSDSD 67
            :.:|::  :.:.|::|..|..:.         :||.||              ..|:|||:.:||.
  Rat    12 VLLGVS--LGLAIIVLAVVLPHH---------QASCRP--------------DAFTRAAVAADSK 51

  Fly    68 VCSQLAKKVLENGGSAVDGALAALICNGLIGMQSMGIGGGMVMNVYVAKENKSYSILAREMAPLA 132
            :||.:.:.:|:..||.||.|:|||||.|::..||||:|||:|..:|.|...|...|.|||..|.:
  Rat    52 ICSDIGRVILQQQGSPVDAAIAALICTGVVNPQSMGLGGGVVFTIYNASTGKVEVINARETVPAS 116

  Fly   133 LRADNFSSFRDEQDFKR----------SGWSIAVPAELAGYAVAHQRFGRLKWKDLVLPTLELCR 187
                     .|::...:          :.| |.||.||.|||.||:|:|||.|..|..||:.|.|
  Rat   117 ---------HDQRLLDQCTNALPLCTGAQW-IGVPGELRGYAEAHRRYGRLPWAQLFQPTIALLR 171

  Fly   188 RGYRL--YKHQYDALILNQDMIRA---DSGLRRMFID-PDTGRF-----WPLGHLIRPAAQLCNT 241
            .|:|:  ...|:    ||...::.   .|.||::|.: .:|.|.     ||         .|.||
  Rat   172 EGFRVPPILSQF----LNTSFLQPCLNSSTLRQLFFNGTETLRSQDPLPWP---------ALANT 223

  Fly   242 YDRLANEGPLSFYRGSIADDLLADLKDAGSAITKEDLNQAHAKLSSAIVMPLDEYDLHLTPPPGS 306
            .:.:|.||....|.|.:...|:.|:...||.:|.:||.....|:...:.|.|..|.|:..|||..
  Rat   224 LETVAKEGAEVLYTGKLGQTLVEDIAWQGSQLTVQDLAAFRPKVVEPLEMALGNYTLYSPPPPAG 288

  Fly   307 GHVLGFIMNILKEFRAEFSRAGTMSP----RQIHLMVEAMKFGFVKRWQLDESASEELLSNLTSH 367
            |.:|.||:|:||.|  .||......|    ...|.:|||:||...:||:|.:..|...:.|::..
  Rat   289 GAILSFILNVLKGF--NFSAETVAGPEGKVNMYHHLVEALKFAVGQRWRLWDPYSHPGIQNISQD 351

  Fly   368 ELAKSVARQINH------THTFNRPEFYGASPGIQIRDEHGTAHTSVLHGND--AVSVTSSINFY 424
            .|.:::|:.|..      .|..:.   |..| |:: .:..||:|.||| |.|  ||:.||:||..
  Rat   352 LLRETLAQHIRQQIDGRGDHQLSH---YNLS-GVR-GNSMGTSHVSVL-GEDGSAVAATSTINTP 410

  Fly   425 FGSGRTGRRTGVIFNNAMSDFSIEQLKNYFDLPFVPG---TNGVAPAARPMSSMCPVIVTERATG 486
            ||:.....|||::.||.:.|.....         .||   |....|..:|.|||.|.|:.....|
  Rat   411 FGAMVYSPRTGILLNNELLDLCWRH---------KPGSTVTPPPVPGEQPPSSMVPSILINEVQG 466

  Fly   487 NVRLVVGAAGGTKIISALSPLLVRILWQEASIKAAIDASRIHHQMLPNVLLYEYGLRQSYVDSLA 551
            : :||:|.|||..||||::..:|..||...|:..||.|..:|.....:| .||....|.....|.
  Rat   467 S-KLVIGGAGGELIISAVTQAIVNKLWLGFSLTDAIAAPILHVNSKGHV-EYEPKFNQEVRKGLQ 529

  Fly   552 ERGHRCERYENRGSVICGIAQA----NDTIWVNSDFRKPGGVSGF 592
            :||.  .:.:::..|.....||    ...::..||.||.|..||:
  Rat   530 DRGQ--SQSQSQRPVFLNSVQAVFQEGPCVYAASDLRKAGKASGY 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1492NP_001303553.1 G_glu_transpept 76..587 CDD:279371 180/551 (33%)
Ggt5NP_062108.2 G_glu_transpept 60..567 CDD:279371 180/551 (33%)
Glutamate binding. {ECO:0000250} 453..454 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1419292at2759
OrthoFinder 1 1.000 FOG0000255
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11686
Phylome 1 0.910 0.972 Consistency score
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.