DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1492 and Ggt5

DIOPT Version :8

Sequence 1:NP_001303553.1 Gene:CG1492 / 32164 FlyBaseID:FBgn0030361 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_035950.2 Gene:Ggt5 / 23887 MGIID:1346063 Length:573 Species:Mus musculus

Alignment Length:606 Identity:196/607 (32%)
Similarity:293/607 (48%) Gaps:74/607 (12%)


  Fly    11 ISVVIVILVAVYIYRYPDGNAGKKKASRRPPNPEDPLPPSNSPLHRFSRAAICSDSDVCSQLAKK 75
            :.:|||:|.||         ...::||..|              ..|:|||:.:||.:||.:.:.
Mouse    18 LGLVIVVLAAV---------LSPRQASCGP--------------GAFTRAAVAADSKICSDIGRA 59

  Fly    76 VLENGGSAVDGALAALICNGLIGMQSMGIGGGMVMNVYVAKENKSYSILAREMAPLALRADNFSS 140
            :|:..||.||.|:|||:|.|::..||||:|||:|..:|.|...|...|.|||..|.:......:.
Mouse    60 ILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKVEIINARETVPASYDQGLLNQ 124

  Fly   141 FRDEQDFKRSGWSIAVPAELAGYAVAHQRFGRLKWKDLVLPTLELCRRGYRL--YKHQYDALILN 203
            .::..........|.||.||.|||.||:|.|||.|..|..||:.|.|.|:|:  ...|:    ||
Mouse   125 CKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLREGFRVPFILSQF----LN 185

  Fly   204 QDMIR---ADSGLRRMFID-PDTGRF-----WPLGHLIRPAAQLCNTYDRLANEGPLSFYRGSIA 259
            ..::|   :.|.||::|.: .:|.|.     ||         .|.||.:.:|.||....|.|.:.
Mouse   186 NSILRPHLSASTLRQLFFNGTETLRSQDPFPWP---------ALANTLETVAKEGAEVLYTGRLG 241

  Fly   260 DDLLADLKDAGSAITKEDLNQAHAKLSSAIVMPLDEYDLHLTPPPGSGHVLGFIMNILKEFRAEF 324
            ..|:.|:...||.:|.:||.....::...:.|||..|.|:..|||..|.:|.||:|:||.|  .|
Mouse   242 RMLVEDIAKQGSLLTVQDLAAFQPEVVEPLEMPLGNYTLYSPPPPAGGAILSFILNVLKGF--NF 304

  Fly   325 SRAGTMSP----RQIHLMVEAMKFGFVKRWQLDESASEELLSN----LTSHELAKSVARQINHTH 381
            |......|    ...|.:||.:||...:||:|.:.:|...:.|    |...:||:.:.:||:...
Mouse   305 SAETVARPGGEVNMYHHLVETLKFAVGQRWRLWDPSSHPGIQNISRDLLREDLAQRIRQQIDGRG 369

  Fly   382 TFNRPEFYGASPGIQIRDEHGTAHTSVLHGND--AVSVTSSINFYFGSGRTGRRTGVIFNNAMSD 444
            ..::...|..: |:: .:..||:|.||| |.|  ||:.||:||..||:.....|||::.||.:.|
Mouse   370 DHHQLSHYNLT-GVR-GNRMGTSHVSVL-GEDGSAVAATSTINTPFGAMVYSPRTGILLNNELLD 431

  Fly   445 FSIEQLKNYFDLPFVPGTNGVAPAARPMSSMCPVIVTERATGNVRLVVGAAGGTKIISALSPLLV 509
            ..      :..:|..|.|....|..||.|||.|.|:..:..|: :||:|.|||..||||::..::
Mouse   432 LC------WRHMPTSPITPPPVPGERPPSSMVPSILVNKGQGS-KLVIGGAGGELIISAVAQTIM 489

  Fly   510 RILWQEASIKAAIDASRIHHQMLPNVLLYEYGLRQSYVDSLAERGHRCERYENRG---SVICGIA 571
            ..||....:..|| ||.|.|......:.||....|.....|.:|| :.:....|.   :.:..:.
Mouse   490 NKLWLGFDLTEAI-ASPILHVNSKGHVEYEPKFNQEVQKGLQDRG-QIQSQSQRPVFLNAVQAVF 552

  Fly   572 QANDTIWVNSDFRKPGGVSGF 592
            |....::..||.||.|..||:
Mouse   553 QEGPCVYAASDLRKAGKASGY 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1492NP_001303553.1 G_glu_transpept 76..587 CDD:279371 176/535 (33%)
Ggt5NP_035950.2 G_glu_transpept 60..568 CDD:279371 176/535 (33%)
Glutamate binding. {ECO:0000250} 454..455 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110876122
eggNOG 1 0.900 E1_COG0405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1419292at2759
OrthoFinder 1 1.000 FOG0000255
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11686
Phylome 1 0.910 0.973 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.