DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1492 and C53D5.5

DIOPT Version :8

Sequence 1:NP_001303553.1 Gene:CG1492 / 32164 FlyBaseID:FBgn0030361 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_490714.1 Gene:C53D5.5 / 171619 WormBaseID:WBGene00016906 Length:642 Species:Caenorhabditis elegans

Alignment Length:618 Identity:210/619 (34%)
Similarity:319/619 (52%) Gaps:66/619 (11%)


  Fly     5 IGLNSLISVVIVILVA---VYIYRYPDGNAGKKKASRRPPNPEDPLPPSNSPLHRFSRAAICSDS 66
            :||..|:..:::..||   :|.:.....||      |.|..|    .||.|||.::|:||:.:|:
 Worm    56 VGLTVLVFTLLISTVAFASLYFHLLMQNNA------RLPRWP----GPSLSPLGKYSKAAVAADN 110

  Fly    67 DVCSQLAKKVLENGGSAVDGALAALICNGLIGMQSMGIGGGMVMNVYVAKENKSYSILAREMAPL 131
            ::||::.:.:|..||:|||.|:|||.|.|::...|.|||||..|.:|.|...:...|.|||:|||
 Worm   111 EICSEIGRNILLKGGNAVDSAIAALFCIGVMDTHSAGIGGGHFMTIYNATTKECTVIDAREIAPL 175

  Fly   132 ALRADNFSSFRDEQDFKRSGW-SIAVPAELAGYAVAHQRF--GRLKWKDLVLPTLELCRRGYRLY 193
            |...:   .:||:.:..|.|| :||||.||.|.....:||  |:::|:.|:.||::|...||...
 Worm   176 AATEE---MYRDKWNQSRIGWKAIAVPGELHGLRTEFERFGSGKVEWRQLLKPTIDLLAEGYPTS 237

  Fly   194 KHQYDALILNQDMIRADSGLRRMFIDPDTGRFWPLGHLIRPAAQLCNTYDRLANE-GPLS-FYRG 256
            .....||..|:..|||:..::. ||:|:|.|.:..|..|:....|..|:..|||. .|:: ||.|
 Worm   238 HALAKALNQNEHQIRAEPTMKN-FINPETQRVFQPGEQIKTRQNLLETFRLLANSTDPIADFYTG 301

  Fly   257 SIADDLLADLKDAGSAITKEDL-----------NQAHAKLSS--AIVMPLDEYDLHLTPPPGSGH 308
            .:|:.|..:.:..|..|..:|.           |..:.||.:  .:..|         |||....
 Worm   302 RLAEQLAKEFEANGGIIRLQDFKNYKSIVHDSKNVIYTKLKNGRGVCGP---------PPPSGSA 357

  Fly   309 VLGFIMNILKEFR---AEFSRAGTMSPRQIHLMVEAMKFGFVKR-WQLDE---SASEELLSNLTS 366
            |...|:|::..|.   ..|:...|:    .|..:|:.||.:..| |..|.   :.:.|:..|:||
 Worm   358 VAQAILNVMDGFEYNMKSFNEIATL----YHHFLESSKFSYAARSWLGDPQFVANATEIAKNITS 418

  Fly   367 HELAKSVARQINHTHTFNRPEFYGASPGIQIRDEHGTAHTSVLHGN-DAVSVTSSINFYFGSGRT 430
            .|.|..|..:|  |.|.:..::||.|.....:| |||.|.|::..: :||||||:||.|.|:..:
 Worm   419 KEWADWVRSKI--TDTTHPDDYYGGSFEAPPQD-HGTTHVSIIDADGNAVSVTSTINLYLGALVS 480

  Fly   431 GRRTGVIFNNAMSDFSIEQLKNYFDLPFVPGTNGVAPAARPMSSMCPVIVTERATGNVRLVVGAA 495
            ...||:::||.|.|||.....|:|..|..| .|.:.|..|||||..|:::. ...|...:.||.|
 Worm   481 SESTGILWNNEMDDFSTPGHPNFFGFPPSP-ANFIRPGKRPMSSQSPLVIF-NTKGAELMAVGGA 543

  Fly   496 GGTKIISALSPLLVRILWQEASIKAAIDASRIHHQMLPNVLLYEYGLRQSYVDSLAERGHRCERY 560
            ||:.|||.::.:.:..||.:|.:|.|:||.|:|:|:.||...||....::||.||.:|||..:..
 Worm   544 GGSTIISGVAGVALHALWLKADVKQAVDAPRMHNQLQPNYTWYEPNFPKAYVKSLIDRGHVMKAV 608

  Fly   561 ENRGSVICGIAQANDTIWVNSDFRK-----PGG 588
            .|...|......::..|:.||||||     |.|
 Worm   609 NNLTVVTAAERLSDGQIYANSDFRKGEESAPAG 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1492NP_001303553.1 G_glu_transpept 76..587 CDD:279371 187/542 (35%)
C53D5.5NP_490714.1 G_glu_transpept 119..633 CDD:279371 185/536 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C4550837
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1876
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1419292at2759
OrthoFinder 1 1.000 FOG0000255
OrthoInspector 1 1.000 T97974
orthoMCL 1 0.900 OOG5_127021
Panther 1 1.100 O PTHR11686
Phylome 1 0.910 0.902 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.