DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1492 and LOC110439994

DIOPT Version :8

Sequence 1:NP_001303553.1 Gene:CG1492 / 32164 FlyBaseID:FBgn0030361 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_021333878.1 Gene:LOC110439994 / 110439994 -ID:- Length:131 Species:Danio rerio

Alignment Length:132 Identity:46/133 (35%)
Similarity:71/133 (53%) Gaps:27/133 (20%)


  Fly     9 SLISVVIVILVAVYIYRYPDGNAGKKKASRRPPNPEDPLPPSNSPLHRFSRAAICSDSDVCSQLA 73
            ||:.:|||||:.|.|..                        ||:   .::.||:.:|:..||::.
Zfish    16 SLVIIVIVILIVVRIVL------------------------SNT---CYNNAAVAADARKCSEIG 53

  Fly    74 KKVLENGGSAVDGALAALICNGLIGMQSMGIGGGMVMNVYVAKENKSYSILAREMAPLALRADNF 138
            :.:|:..|||||.|:|||:|..|:..||||||||:|..:|.|...|..:|.:||.||::...:.|
Zfish    54 RDILQRNGSAVDAAIAALLCVSLVNAQSMGIGGGLVFTIYNASSGKVETINSRETAPMSASENMF 118

  Fly   139 SS 140
            .:
Zfish   119 GT 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1492NP_001303553.1 G_glu_transpept 76..587 CDD:279371 30/66 (45%)
LOC110439994XP_021333878.1 G_glu_transpept 55..>127 CDD:327525 30/67 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D176986at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.