DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1492 and ggt7

DIOPT Version :8

Sequence 1:NP_001303553.1 Gene:CG1492 / 32164 FlyBaseID:FBgn0030361 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_021325551.1 Gene:ggt7 / 101882295 -ID:- Length:668 Species:Danio rerio

Alignment Length:537 Identity:152/538 (28%)
Similarity:259/538 (48%) Gaps:45/538 (8%)


  Fly    57 FSRAAICSDSDVCSQLAKKVLENGGSAVDGALAALICNGLIGMQSMGIGGGMVMNVYVAKENKSY 121
            :|:||:.:|...|:.|...||...||:||.|:||.:|.|:|...|.|||||.||.|:..::|:|.
Zfish   142 YSQAAVVTDVSRCTTLGLDVLGKQGSSVDAAIAASLCLGIIHPHSSGIGGGGVMLVHDIRKNESR 206

  Fly   122 SILAREMAPLALRADNFSSFRDEQDFKRSGWSIAVPAELAGYAVAHQRFGRLKWKDLVLPTLELC 186
            .|..||..|..|..|..     :....|.|.::|||..::|...|||.:||:.||::|....::.
Zfish   207 VIDFRETVPSGLHEDMM-----QHASHRPGLTVAVPGLISGLHQAHQLYGRMSWKNVVSMAADVA 266

  Fly   187 RRGYRLYKHQYDALILNQDMIRADSGLRRMFI---DPDTGRFWPLGHLIRPAAQLCNTYDRLANE 248
            |.|:.:.....|||...:....:|| .|.:|:   .|      ||..|......|....|::|..
Zfish   267 RTGFNITHELADALSKVKQQNVSDS-FRDVFLPAGQP------PLAGLFARRLDLAALLDKIAAN 324

  Fly   249 GPLSFYRGSIADDLLADLKDAGSAITKEDLNQAHAKLSSAIVMPLDE----YDLHLTPPPGSGHV 309
            |...||..::..::.:.::..|..:|:||..    ..::.|..||..    ..:.:.|||.:|..
Zfish   325 GISEFYSSNLTQEMTSAVQANGGVLTEEDFR----NYTTVIQTPLQSLYQGQQVFVPPPPQAGVA 385

  Fly   310 LGFIMNILKEFRAEFSRAGTMSPRQ--IHLMVEAMKFGFVKRWQLDESASEELLSNLTSHELAKS 372
            |...:|||:.|     ...:.:||.  .|.:.:::|....:...|.:|..:..:|.|.:..|:|:
Zfish   386 LLSALNILEGF-----NISSQTPRSSVYHWVADSLKIALSQASGLGDSMFDSSVSELVAEMLSKT 445

  Fly   373 VA---RQINHTHTFNRPEFYGASPGIQIRDEHGTAHTSVLHGND--AVSVTSSINFYFGSGRTGR 432
            .|   ||:......:..:.|  :|..:::|.:.....|:: |.|  .|||.||:|..||||.. .
Zfish   446 QAAAFRQMISDTLASTADHY--TPSYELQDTNEAGQISIM-GTDNLIVSVMSSLNRPFGSGIV-T 506

  Fly   433 RTGVIFNNAMSDFSIEQLKNYFDLPFVPGTNGVAPAARPMSSMCPVIVTERATG--NVRLVVGAA 495
            .:|::.|:.:.|||... |......| ...|.:||..||:|.:.|:.| ..:.|  ...:.:|:.
Zfish   507 SSGILLNSQILDFSWPN-KTLSSSAF-NQRNSIAPGKRPLSFLLPLAV-RPSVGQCGTYIALGSC 568

  Fly   496 GGTKIISALSPLLVRILWQEASIKAAIDASRIHHQMLPNVLLYEYGLRQSYVDSLAERGHRCERY 560
            .|.:.:|.::.:||.:|....::..::.:.|:|..:..|.||.:...:::.|.:|..:||...|.
Zfish   569 SGDRALSGITQVLVNVLSSRRNMSESVSSGRLHPLISNNSLLVDSVFQEADVKALQAKGHDVLRV 633

  Fly   561 ENRGSVICGIAQANDTI 577
            | |.|::.|..:.||.|
Zfish   634 E-RLSLVEGTRRTNDLI 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1492NP_001303553.1 G_glu_transpept 76..587 CDD:279371 146/519 (28%)
ggt7XP_021325551.1 G_glu_transpept 160..657 CDD:327525 146/520 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1419292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.